KEGG   Streptococcus pneumoniae R6 (avirulent): spr0922Help
Entry
spr0922           CDS       T00060                                 

Gene name
tdk
Definition
(RefSeq) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
spr  Streptococcus pneumoniae R6 (avirulent)
Pathway
spr00240  Pyrimidine metabolism
spr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    spr0922 (tdk)
Enzymes [BR:spr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     spr0922 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD
Motif
Other DBs
NCBI-GeneID: 933593
NCBI-ProteinID: NP_358516
UniProt: Q8DPZ6
LinkDB All DBs
Position
909208..909807
Genome map
AA seq 199 aa AA seqDB search
MAQLYYRYGTMNSGKTIEILKVAYNYEEQGKGVVIMTSALDTRDGVGYVSSRIGMKRPAL
AIEETTDIFGYIRDLPEKPYCVLVDEAQFLKRHHVYDLARVVDELDIPVMAFGLKNDFRN
ELFEGSKYLLLLADKIDEIKTICQYCKKKATMVLRTQDGLPVYDGEQIQIGGNETYISVC
RKHYFAPMITSNKEQNYDN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atggcacagttgtactatcgttatgggaccatgaactctggtaaaacgattgagattctc
aaagtggcctataactacgaggagcaaggaaaaggtgttgtcattatgacctcggctctg
gatacgcgtgacggtgttggctatgtgtcgagtcgaattggcatgaaacgccctgccctt
gcgattgaggaaacaacggatatctttggctatatccgagacctaccagaaaaaccttac
tgtgttttggtcgatgaagcccagtttcttaaacgccaccatgtttacgacctagctcgt
gttgtggacgagttagacatacccgtcatggcttttggcttgaaaaatgactttcgcaat
gaattgttcgaaggttccaaatatctcttgcttttagcggacaagattgacgaaatcaag
accatctgtcagtattgcaagaaaaaggcgaccatggtgttgcgaacacaggatggactg
cccgtttacgatggagaacagatccagattggtggtaatgaaacctatatctcggtttgc
cgtaaacattattttgcgccaatgataacctctaacaaggagcaaaactatgacaattga

DBGET integrated database retrieval system