KEGG   Streptococcus pneumoniae R6 (avirulent serotype 2): spr1577Help
Entry
spr1577           CDS       T00060                                 

Gene name
stkP
Definition
(RefSeq) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
spr  Streptococcus pneumoniae R6 (avirulent serotype 2)
Brite
KEGG Orthology (KO) [BR:spr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spr01001]
    spr1577 (stkP)
Enzymes [BR:spr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     spr1577 (stkP)
Protein kinases [BR:spr01001]
 Serine/threonine kinases: Other
  Bacterial family
   spr1577 (stkP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase PASTA Pkinase_Tyr APH Kinase-like RIO1 Kdo Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 933070
NCBI-ProteinID: NP_359169
UniProt: Q8DNS0
LinkDB All DBs
Structure
PDB: 

Position
complement(1556104..1558083)
Genome map
AA seq 659 aa AA seqDB search
MIQIGKIFAGRYRIVKQIGRGGMADVYLAKDLILDGEEVAVKVLRTNYQTDPIAVARFQR
EARAMADLDHPHIVRITDIGEEDGQQYLAMEYVAGLDLKRYIKEHYPLSNEEAVRIMGQI
LLAMRLAHTRGIVHRDLKPQNILLTPDGTAKVTDFGIAVAFAETSLTQTNSMLGSVHYLS
PEQARGSKATVQSDIYAMGIIFYEMLTGHIPYDGDSAVTIALQHFQNPLPSVIAENSSVP
QALENVIIKATAKKLTNRYRSVSEMYVDLSSSLSYNRRNESKLIFDETSKADTKTLPKVS
QSTLTSIPKVQAQTEHKSIKNPSQAVTEETYQPQAPKKHRFKMRYLILLASLVLVAASLI
WILSRTPATIAIPDVAGQTVAEAKATLKKANFEIGEEKTEASEKVEEGRIIRTDPGAGTG
RKEGTKINLVVSSGKQSFQISNYVGRKSSDVIAELKEKKVPDNLIKIEEEESNESEAGTV
LKQSLPEGTTYDLSKATQIVLTVAKKATTIQLGNYIGRNSTEVISELKQKKVPENLIKIE
EEESSESEPGTIMKQSPGAGTTYDVSKPTQIVLTVAKKVTSVAMPSYIGSSLEFTKNNLI
QIVGIKEANIEVVEVTTAPAGSVEGMVVEQSPRAGEKVDLNKTRVKISIYKPKTTSATP
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgatccaaatcggcaagatttttgccggacgctatcggattgtcaaacagattggtcga
ggaggcatggcggatgtctacctagccaaagacttaatcttagatggggaagaagtggca
gtgaaggttctgaggaccaactaccagacggacccgatagctgtagctcgttttcagcgt
gaagcgagagctatggcagatctagaccatcctcatatcgttcggataacagatattggt
gaggaagacggtcaacagtatcttgcaatggagtatgttgctggactagacctcaaacgc
tatatcaaggaacattatcctctttctaatgaagaagcagtccgtatcatgggacaaatt
ctcttggctatgcgcttggcccatactcgaggaattgttcacagggacttgaaacctcaa
aatatccttttgacaccagatgggactgccaaggtcacagactttgggattgctgtagcc
tttgcagagacaagtctgacccagactaactcgatgttgggctcagttcattacttgtca
ccagagcaggcgcgtggttcgaaggcgactgtgcagagtgatatctatgccatggggatt
attttctatgagatgttgacaggccatatcccttatgacggggatagcgcggtgaccatt
gccctccagcatttccagaaccccctgccgtccgttattgcagaaaattcatctgtacct
caggctttagaaaatgttattatcaaggcaactgctaaaaagttgaccaatcgctatcgc
tcggtttcagagatgtatgtagacttgtctagtagcttgtcctacaatcgtagaaatgaa
agtaagttaatctttgatgaaacgagcaaggcagataccaagaccttgccgaaggtttct
cagagtaccttgacatctattcctaaggttcaagcgcagacagaacacaaatcaatcaaa
aacccaagccaggctgtgacagaggaaacttaccaaccacaagcaccgaaaaaacataga
tttaagatgcgttacctgattttgttggccagccttgtattggtggcagcttctcttatt
tggatactatccagaactcctgcaaccattgccattccagatgtggcaggtcagacagtt
gcagaggccaaggcaacgctcaaaaaagccaattttgagattggtgaggagaagacagag
gctagtgaaaaggtggaagaagggcggattatccgtacagatcctggcgctggaactggt
cgaaaagaaggaacgaaaattaatctggttgtctcatcaggcaaacaatccttccaaatt
agtaattatgtcggccggaaatcttctgatgttatcgcggaattaaaagagaaaaaagtt
ccagataatttgattaaaattgaggaagaagagtcgaatgaaagtgaggctggaacggtc
ctgaagcaaagtctaccagaaggtacgacctatgacttgagcaaggcaactcaaattgtt
ttgacagtagctaaaaaagctacgacgattcaattagggaactatattggacggaactct
acagaagtaatctcagaactcaagcagaagaaggttcctgagaatttgattaagatagag
gaagaagagtccagcgaaagcgaaccaggaacgattatgaaacaaagtccaggtgccgga
acgacttatgatgtgagtaaacctactcaaattgtcttgacagtagctaaaaaagttaca
agtgttgccatgccgagttacattggttccagcttggagtttactaagaacaatttgatt
caaattgttgggattaaggaagctaatatagaagttgtagaagtgacgacagcgcctgca
ggtagtgtagaaggcatggttgttgaacaaagtcctagagcaggtgaaaaggtagaccta
aataagactagagtcaagatttcaatctacaaacctaaaacaacttcagctactccttaa

DBGET integrated database retrieval system