KEGG   Streptomyces pristinaespiralis: SPRI_1068Help
Entry
SPRI_1068         CDS       T04073                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
spri  Streptomyces pristinaespiralis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ALC19374
UniProt: A0A0M5IPG4
LinkDB All DBs
Position
1273845..1274900
Genome map
AA seq 351 aa AA seqDB search
MPPVKPMLAKAVKKIPPGMHYEAKWDGFRAIVHRDGDELVIGSRTGKPLTRYFPELVTSL
SENLPARCVIDGEIVIAHEGRLDFDRLTERIHPADSRVRMLAERTPASFVAFDVLALGDE
SLMDAPLGARRERLEEALADARPPVHLTPTTTDVEVAQRWFEQYEGAGLDGVVAKPLDLP
YRPDVRLMYKVKHERTADVVVAGYRFHKSGPVVGSLLLGLFDDSGALQHVGVCAAFSMKR
REELVAELEPLRMDPVEGHPWAAWAEESAHAGARLPGAPSRWSGKKDLSWVALRPERVVE
VAYDHMEGDRFRHTAQFRRWRPDRDPSSCTYAQLEEPVSYDLAQVLPPSGG
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgcccgtgaagccgatgctcgccaaggccgtgaagaagattccgccgggaatgcac
tacgaggcaaaatgggacggcttccgcgcgatcgtgcaccgcgacggcgatgagctggtc
atcgggtcccgcaccggcaagcccctcaccaggtactttcccgagctggtgacctccctg
tcggagaacctgccggcccgttgcgtcatcgacggggagatcgtcatcgcgcacgaggga
cggctggacttcgaccggctcaccgagcgcatccaccccgcggactccagggtgcggatg
ctcgccgagcggacacccgccagtttcgtcgcgttcgacgtgctcgcgctcggcgacgag
tcgctgatggacgccccgctcggcgcccggcgggaacggctcgaggaggccctcgccgac
gcccggccgccggtgcacctcacgccgacgaccaccgacgtcgaggtcgcgcagcggtgg
ttcgagcagtacgagggggccgggctcgacggtgtcgtcgccaagccgctggatctgccg
taccggccggacgtccggctgatgtacaaggtcaagcacgagcgcaccgccgacgtcgtc
gtcgccggttaccgcttccacaagagcgggccggtcgtcggttcgctgctgctcgggctg
ttcgacgactccggggcgctccagcacgtcggagtctgcgccgctttctcgatgaagcgg
cgggaggagctggtggcggagctggagccgctgcgcatggacccggtcgagggtcatccc
tgggccgcctgggcggaggagagcgcccatgcgggcgccaggctccccggcgcgccgagc
cgctggtcgggcaagaaggacctgtcctgggtggcgttgcggcccgagcgggtcgtggag
gtggcctacgaccacatggagggcgaccgtttccggcacaccgcgcagttccggcggtgg
cgtccggaccgggacccctccagctgcacgtacgcgcagctggaggagccggtgagctac
gacctggcccaggtgctgcccccgtcaggcgggtga

DBGET integrated database retrieval system