KEGG   Streptomyces pristinaespiralis: SPRI_1792Help
Entry
SPRI_1792         CDS       T04073                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00071  Fatty acid degradation
spri00280  Valine, leucine and isoleucine degradation
spri00281  Geraniol degradation
spri00362  Benzoate degradation
spri00592  alpha-Linolenic acid metabolism
spri01100  Metabolic pathways
spri01110  Biosynthesis of secondary metabolites
spri01120  Microbial metabolism in diverse environments
spri01130  Biosynthesis of antibiotics
spri01212  Fatty acid metabolism
Module
spri_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPRI_1792
   00592 alpha-Linolenic acid metabolism
    SPRI_1792
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPRI_1792
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    SPRI_1792
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPRI_1792
   00642 Ethylbenzene degradation
    SPRI_1792
Enzymes [BR:spri01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     SPRI_1792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ALC20098
UniProt: A0A0M5IXG6
LinkDB All DBs
Position
2075825..2077051
Genome map
AA seq 408 aa AA seqDB search
MPRTVRDVVFVDGVRTPFGKAGPKGIYHETRADDLVVKAIRELLRRNPALDPAKIDEVAI
AATTQIGDQGLTLGRTAGILAGLPQSVPGYSIDRMCAGALTAVTSVAGSIAFGAYDAVIA
GGVEHMGRHPMGEGVDPNPRFVSEKLVDESALFMGMTAENLHDRYPQITKQRADEYAVRS
QEKAAKAYANGKIQQDLVPVSVRRTNPEAGETGWGLVTADEPMRPGTTLESLAGLKTPFR
VHGRVTAGNAAGLNDGATASIIASEEFARENDLPVRMRLVSYAFAGVEPEVMGYGPIPAT
EKALAKAGLSIEDINLFEINEAFAVQVLAFLEHYGIADDDARVNQYGGAIAYGHPLASSG
VRLMTQLARQFEEQPEVRYGLTTMCVGFGMGATVIWENPHHKDAGGDK
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
gtgcctcgtaccgtcagggacgtcgtcttcgtcgacggcgtccgcaccccgttcggcaag
gcgggcccgaagggcatctaccacgagacccgcgccgacgatcttgtcgtgaaggccatc
cgggagctgctgcgccgcaacccggccctcgaccccgcgaagatcgacgaggtcgccatc
gccgcgaccacgcagatcggtgaccagggtctgaccctcggccgtaccgccggcatcctc
gccggtctgccgcagtccgtgcccggctactccatcgaccggatgtgcgccggtgcgctc
accgccgtgacgagcgtcgccggttccatcgcgttcggcgcgtacgacgccgtcatcgcc
ggtggtgtcgagcacatgggccgtcaccccatgggcgagggcgtcgacccgaacccgcgc
ttcgtcagcgagaagctcgtcgacgagtccgccctcttcatgggcatgaccgcggagaac
ctgcacgaccggtacccgcagatcaccaagcagcgcgccgacgagtacgccgtgcgttcg
caggagaaggccgccaaggcgtacgccaacggcaagatccagcaggacctggtgccggtc
tccgtccgccgcaccaacccggaggccggcgagaccggctggggcctggtcaccgccgac
gagccgatgcgcccgggcaccacgctcgagtccctcgcgggcctgaagacgccgttccgc
gtccacggccgcgtcaccgccggcaacgccgcgggcctgaacgacggcgcaaccgcctcg
atcatcgcgtccgaggagttcgcccgcgagaacgacctcccggtcaggatgcgcctcgtc
tcgtacgccttcgccggtgtcgagccggaggtcatgggctacggcccgatccccgcgacc
gagaaggccctcgccaaggccggcctgtcgatcgaggacatcaacctcttcgagatcaac
gaggccttcgccgtccaggtgctggcgttcctcgagcactacggcatcgccgacgacgac
gcccgcgtcaaccagtacggcggcgcgatcgcgtacggccacccgctggcctcgtccggt
gtgcgtctgatgacccagctggcccgtcagttcgaggagcagccggaggtccgctacggc
ctcacgacgatgtgcgtcggcttcggcatgggcgccacggtcatctgggagaacccgcac
cacaaggacgccggaggcgacaagtga

DBGET integrated database retrieval system