KEGG   Streptomyces pristinaespiralis: SPRI_2298Help
Entry
SPRI_2298         CDS       T04073                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00473  D-Alanine metabolism
spri00550  Peptidoglycan biosynthesis
spri01100  Metabolic pathways
spri01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SPRI_2298
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SPRI_2298
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    SPRI_2298
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spri01011]
    SPRI_2298
Enzymes [BR:spri01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SPRI_2298
Peptidoglycan biosynthesis and degradation proteins [BR:spri01011]
 Precursor biosynthesis
  Amino acid ligase
   SPRI_2298
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_4 ATP-grasp ATPgrasp_ST ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ALC20604
UniProt: A0A0M4D3V2
LinkDB All DBs
Position
complement(2708832..2709989)
Genome map
AA seq 385 aa AA seqDB search
MSTENLPQSPEQQLRKPRVAVVFGGRSSEHGISVVTAGAVLRAIDRTKYDVLPIGITADG
RWALTADEPERMAITDRRTPNVEELAESDEGGVVLSVDPGSREVVYSEPGSVPKALGEVD
AVFPMLHGPYGEDGTLQGLLELSGVPYVGSGVLASAVGQDKEYMKRVFVSFGLPVGPYEV
IRPREWANDPAAARKKIVDFAGEHGWPLFIKPARGGSSMGITKVDDLAGLDDAIAEAQRH
DPKILVESLLRGREIECGVLEFEDGPRASVPAEIPPVTSHDFYDFEAKYIDSAAGLVPAP
LTDEQTAEVQRLAVAAFDAASCEGLVRADFFLTEDGEFVINEINTMPGFTPISMYPRMWQ
ESGVAYTELVDRLIQAALTRSTGLR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgagaacctcccccagagccccgagcagcagctccgcaagccgcgcgtagcc
gtcgtcttcggcggccgcagctccgaacacgggatctccgtggtcaccgcgggcgcggtg
ctgcgggccatcgaccgcaccaagtacgacgtcctgccgatcggcatcaccgccgacggc
cggtgggcgctcaccgccgacgagccggagcggatggcgatcaccgaccgccggacgccg
aacgtcgaggagctcgcagagtccgacgagggcggcgtggtgctctccgtcgaccccggc
agccgtgaggtcgtctacagcgagcccggctccgtgcccaaggcgctcggcgaggtcgac
gccgtcttccccatgctgcacggcccgtacggcgaggacggcacgctccagggcctgctc
gaactctccggcgtcccgtacgtcggctccggtgtgctcgcctcggccgtcggccaggac
aaggagtacatgaagcgggtcttcgtctccttcggcctgcccgtcggcccctacgaggtg
atccggccgcgcgagtgggcgaacgacccggcggccgcccgtaagaagatcgtggacttc
gcgggcgagcacggctggccgctgttcatcaagcccgcccgcggcggttcctccatgggc
atcaccaaggtcgacgacctggcggggctggacgacgcgatcgccgaggcgcagcgccac
gaccccaagatcctcgtggagtcgctgctgcggggccgtgagatcgagtgcggcgtgctc
gagttcgaggacggcccgcgcgccagtgtcccggccgagatcccgccggtgacctcccac
gacttctacgacttcgaggccaagtacatcgactcggcggccggtctggtccccgccccg
ctcaccgacgagcagaccgcagaggtgcagcggctggcggtcgcggcgttcgacgcggcg
tcgtgcgagggcctggtccgcgcggacttcttcctcacggaggacggcgagttcgtcatc
aacgagatcaacaccatgccgggcttcaccccgatctccatgtacccgcggatgtggcag
gagagcggcgtcgcctacaccgaactggtggaccggctgatccaggccgccctgacccgc
tcgacgggactgcgctga

DBGET integrated database retrieval system