KEGG   Streptomyces pristinaespiralis: SPRI_2570Help
Entry
SPRI_2570         CDS       T04073                                 

Definition
(GenBank) ATP-dependent DNA ligase
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:spri00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    SPRI_2570
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spri03400]
    SPRI_2570
Enzymes [BR:spri01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     SPRI_2570
DNA repair and recombination proteins [BR:spri03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     SPRI_2570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ALC20876
UniProt: A0A0M4DAJ9
LinkDB All DBs
Position
3056019..3056906
Genome map
AA seq 295 aa AA seqDB search
MTPITDVEGRRLALTNLEKVIHPATGTTKGEIVHYYAVMAEAILPHLRDRPVSFLRYPDG
PDGQLFFTKNPPPGTPEWVRTAPVPRSEDPKARQVVIDDLPSLVWAANLVVEFHTPQWRA
DEPAVADRLVFDLDPGAPATIAECCEVALWLRERLARDGLEAYAKTSGSKGLHLVVPVTP
TPSEQVSAYAKSLAVEGEAALPKLMLHRMARSLRPGKVFVDHSQNAAAKTTATPYTLRAR
TEPAVSAPVTWEEVEEGRADGAGLVFALHDIAPRLERYGDLFAPVDDPGGAGSLP
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgacgccgatcacggacgtggaggggcggcgcctggcgctcaccaacctggagaaggtc
atccatcccgccacgggcaccaccaagggcgagatcgtgcactactacgccgtcatggcg
gaggcgatccttccccatctgcgggaccgcccggtgtccttcctgcgatacccggacggg
ccggacgggcagctgttcttcaccaagaacccgccgccgggcaccccggagtgggtgcgc
acggcgccggtcccccgctcggaggaccccaaggcccgccaggtcgtgatcgacgacctg
ccgtcactcgtatgggcggccaacctggtggtcgagttccacaccccgcagtggcgggcg
gacgagcccgccgtcgccgaccgtctggtcttcgacctcgatcccggcgcgcccgcgacc
atcgccgagtgctgcgaggtcgcactgtggctgcgcgagcggctcgcgcgggacgggctg
gaggcgtacgcgaagacatccggctccaagggcctgcacctggtcgtaccggtgacgccc
accccctccgagcaggtctccgcctacgcgaagtccctggccgtcgagggcgaggccgcc
ctgccgaagctgatgctgcaccggatggcccggtcgctgcggcctggcaaggtcttcgtc
gaccacagccagaacgcggccgcgaagacgaccgccaccccgtacaccctgcgggcgcgc
acggagccggccgtctccgcaccggtcacctgggaagaggtcgaggagggccgcgcggac
ggcgccggactcgtcttcgcgctccacgacatcgcgccccggctggagcggtacggagac
ctgttcgcgcccgtggacgaccccggcggcgcaggaagcctgccgtga

DBGET integrated database retrieval system