KEGG   Streptomyces pristinaespiralis: SPRI_2619Help
Entry
SPRI_2619         CDS       T04073                                 

Definition
(GenBank) superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
spri  Streptomyces pristinaespiralis
Brite
KEGG Orthology (KO) [BR:spri00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPRI_2619
Enzymes [BR:spri01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPRI_2619
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni BtrH_N HSR
Motif
Other DBs
NCBI-ProteinID: ALC20925
UniProt: A0A0M4DQV1
LinkDB All DBs
Position
3110654..3111049
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPKVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKYQANEDPHFRARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLINDTLKALSAAKASTDPATGQKALDLIAR
ISDIFAETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctctcccgcctgtttgcccccaaggtgaaggtcagcgcccactgcgacctgccttgc
ggtgtctacgacccggcccaggcccgcatcgaggcggagtcggtcaaggccgtccaggag
aagtaccaggccaacgaggacccgcacttccgcgcccgcgccacggtcatcaaggagcag
cgcgcggagctcgccaagcaccacgtctcggtgctctggagcgactacttcaagccgccg
cacttcgagaagtacccggagctgcaccagctcatcaacgacaccctgaaggcgctctcc
gccgccaaggcgtccacggacccggcgaccggccagaaggccctcgacctcatcgcgcgg
atcagcgacatcttcgcggagaccaagaaggcctga

DBGET integrated database retrieval system