KEGG   Streptomyces pristinaespiralis: SPRI_2995Help
Entry
SPRI_2995         CDS       T04073                                 

Definition
(GenBank) glycosyl transferase
Organism
spri  Streptomyces pristinaespiralis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_2 Glyco_tranf_2_4
Motif
Other DBs
NCBI-ProteinID: ALC21301
UniProt: A0A0M4DB94
LinkDB All DBs
Position
3520000..3520983
Genome map
AA seq 327 aa AA seqDB search
MVKLSVIVPFYNVQTYAPDTLRSLRANARADFEFVLVDDCSTDGTPEILERAERELPGAV
LIRHERNGGLATARNTGLDAAGGQYLTFFDGDDWLAPGHFEHLLDAMEHLGCDFVRTDHV
QCTGRSRSIHRVPVGRRGEVLRPRDVILPASRSTAVDYPYAWAGMYHRRLVDRGLLHFTH
GLRTAEDRPWIWRLHREADSFAAISHLGIFYRRGIASSLTQIGDIRQLDFIKAFDQVIEE
TAKDADAERLLPKAVRTYCAVISHHLGSIERYEPAVARKLRTMSAAALKRMPQDVLNEAI
DSMDADRASRLRKVRRRPAPLSVEAAV
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtggttaagctctccgtcatcgtgccgttctacaacgtgcagacatatgcccccgacaca
ctgcgaagccttcgcgcgaacgcccgcgccgacttcgagttcgtgctcgtcgacgactgt
tcgacggacgggactccggagatcctggagcgcgcggaacgtgagctgccgggcgcggtt
ctgatcagacacgaacgcaacggtgggctcgcgaccgcccgcaacaccggtctggacgcg
gccggcggtcagtacctcaccttcttcgacggcgacgactggctggcgcccggccacttc
gagcacctgctggacgccatggagcacctggggtgcgacttcgtccgcaccgaccatgtg
cagtgcacgggacggtcccgttccatccaccgggtgcccgtcggccggcgcggggaggtg
ctgcgtccgcgggacgtgatcctgcccgcctcccgctcgaccgccgtcgactacccgtac
gcctgggccgggatgtaccaccggcggctcgtggaccgcgggctgctgcacttcacgcac
ggattgcgcaccgcggaggaccggccgtggatatggcggctgcaccgggaagcggattct
ttcgccgcgatcagccacctgggcattttctaccggcgcgggatcgcttcctcgctcact
cagatcggtgacatcaggcagctcgatttcatcaaggcattcgaccaggtgatcgaggaa
acggccaaggacgccgacgcggaaaggctgctgcccaaggcggtccgcacctattgcgcg
gtcatttcccatcacctgggatccatcgaaaggtacgaaccggccgtggcacggaaattg
cgcacgatgagcgcggccgcgctgaagcgcatgccgcaggacgtgctgaacgaggccatc
gactccatggacgccgaccgcgcctcgcggctgcgcaaggtccgccgccggcccgccccc
ctctccgtggaggcggcagtctga

DBGET integrated database retrieval system