KEGG   Streptomyces pristinaespiralis: SPRI_3441Help
Entry
SPRI_3441         CDS       T04073                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00010  Glycolysis / Gluconeogenesis
spri00053  Ascorbate and aldarate metabolism
spri00071  Fatty acid degradation
spri00280  Valine, leucine and isoleucine degradation
spri00310  Lysine degradation
spri00330  Arginine and proline metabolism
spri00340  Histidine metabolism
spri00380  Tryptophan metabolism
spri00410  beta-Alanine metabolism
spri00561  Glycerolipid metabolism
spri00620  Pyruvate metabolism
spri00625  Chloroalkane and chloroalkene degradation
spri00903  Limonene and pinene degradation
spri01100  Metabolic pathways
spri01110  Biosynthesis of secondary metabolites
spri01120  Microbial metabolism in diverse environments
spri01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:spri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPRI_3441
   00053 Ascorbate and aldarate metabolism
    SPRI_3441
   00620 Pyruvate metabolism
    SPRI_3441
  Lipid metabolism
   00071 Fatty acid degradation
    SPRI_3441
   00561 Glycerolipid metabolism
    SPRI_3441
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPRI_3441
   00310 Lysine degradation
    SPRI_3441
   00330 Arginine and proline metabolism
    SPRI_3441
   00340 Histidine metabolism
    SPRI_3441
   00380 Tryptophan metabolism
    SPRI_3441
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPRI_3441
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SPRI_3441
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPRI_3441
Enzymes [BR:spri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SPRI_3441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALC21747
UniProt: A0A0M4DG04
LinkDB All DBs
Position
complement(4005594..4007051)
Genome map
AA seq 485 aa AA seqDB search
MSFFTDLAQQYIDGEWRPGTGSWDIIDFNPYDDEKLASIPVATADEVDQAYRAAERAQRE
WADTNPYARRTVFERALRIIEDREQEITEAIVAELGGTRLKAAFELHLAKEFMREAVHLA
LRPEGRILPSPVDGKENRVYRVPVGVVGVISPFNFPFLLSVKSVAPALALGNAVVLKPHQ
NTPICGGTLVAKVFEEAGLPAGLLNVVITDIAEIGDALIAHPVPKVISFTGSDKVGRHVA
TVCAANFKHAILELGGNSALIVLDDADIDYAVDAAVFSRYVHQGQVCMAANRILVDRSVE
KEFTEKFVAKVRTLKVGDPADPATHIGPLINSSQADAVTALVEQTVEAGATALLHGGTEG
NLVSPSVLTGIPADSPVLTQEIFGPVALIVPFDGEDEAVRIANDTPYGLSGAVHTGDVER
GVRLAKRVDTGMIHINDGTVHDEPIVPFGGEKHSGLGRLNGDSMLDAFTTQKWISVQHGR
SRFPF
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtccttcttcaccgatctggcccagcagtacatagacggcgagtggaggccgggcacc
ggctcctgggacatcatcgacttcaatccgtacgacgacgagaagctcgcctccatcccc
gtggccacggccgacgaggtggaccaggcctaccgggcggcggagcgcgcgcagcgggag
tgggcggacaccaacccgtacgcccgacggaccgtcttcgagcgggccctgcggatcatc
gaggaccgcgagcaggagatcacggaggcgatcgtcgcggagctcggcggcacccgcctc
aaggccgcgttcgagctgcacctcgccaaggagttcatgcgcgaggcggtgcacctggcg
ctgcggccggaggggcgcatcctgccctcgccggtcgacggcaaggagaaccgcgtctac
cgggtgccggtcggcgtggtgggcgtcatcagccccttcaacttccccttcctgctgtcg
gtcaagtcggtcgccccggcgctggccctcggcaacgccgtggtcctcaagccgcaccag
aacaccccgatctgcggtggcacgctggtggccaaggtgttcgaggaggcggggctgccc
gccggtctgctgaacgtcgtgatcaccgacatagccgagataggcgacgcgctcatagcg
caccccgttccgaaggtgatctccttcaccggctccgacaaggtgggccggcacgtcgcc
accgtctgcgcggccaacttcaagcacgccattctcgaactcggcggcaacagcgcgctg
atcgtgctcgacgacgccgacatcgactacgcggtggacgccgcggtcttcagccggtac
gtgcaccagggccaggtctgcatggccgccaaccgcatcctggtggaccgttcggtcgag
aaggagttcaccgagaagttcgtcgccaaggtgcggaccctcaaggtgggcgacccggcg
gacccggcgacccacatcggccccctcatcaactcctcccaggcggacgcggtcaccgcg
ctggtcgagcagaccgtggaggcgggcgcgacggcgctgctgcacggcggcacggagggc
aacctcgtctccccctcggtgctcaccggcattcccgccgactctccggtgctgacacag
gagatcttcggcccggtggcactgatcgtccccttcgacggcgaggacgaggcggtcagg
atcgccaacgacacgccgtacggcctgagcggcgccgtgcacaccggtgacgtggagcgg
ggtgtgcggctcgccaagcgggtggacaccgggatgatccacatcaatgacggcaccgtg
cacgacgagccgatcgtgcccttcggcggcgagaagcactccggtctcggcaggctgaac
ggcgactcgatgctggacgccttcaccacccagaagtggatctcggtccagcacgggcgc
tcgcgcttcccgttctga

DBGET integrated database retrieval system