KEGG   Streptomyces pristinaespiralis: SPRI_5176Help
Entry
SPRI_5176         CDS       T04073                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
spri  Streptomyces pristinaespiralis
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALC23482
UniProt: A0A0M4DW22
LinkDB All DBs
Position
6031164..6032624
Genome map
AA seq 486 aa AA seqDB search
MTELVEHGELFIGGELTAPLGTEVIEVISPHSEQVLGRVPHASRADVDRAVAAARRAFDE
GPWPRATLEERIEVVGRIKDAIAVRHEEIARSISAQNGSPYSWSVLAQALGAMMVWDSAI
SVARDFTHEERRDGVLGPILVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCTVVLKP
SPETPLDSYILGEIAREAGLPEGVLSILPAGREVSEYLVGHKGVDKVSFTGSVEAGRRVM
EVASRNLTRVTLELGGKSAAVILPDADLATAVAGIVPAAWMNNGQACVAQTRILAPRSRY
DEIAEAFAAAASALVVGDPLDAATQVGPLVAERQRRRSLDYIRIGQEEGAKILCGGGRPA
GLERGWYVEPTLFGGVDNSMRIAREEIFGPVICLLPYGDEDEAAAIADDSDYGLSGSVWT
SDVEHGIDFARRVRTGTYNVNTFSLDMLGPFGGYKNSGVGREFGPEGYGEFLEHKMIHLP
AGHGSH
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagctcgtggaacacggagaactgttcatcgggggcgagttgacggccccgctc
ggcacggaagtcatcgaggtgatctccccgcacagcgaacaggtcctcggccgcgtcccg
cacgcctcgcgcgccgatgtggaccgggcggtggccgccgcgcgccgggccttcgacgaa
ggaccctggccgcgggcgacgctcgaggaacggatcgaggtcgtcggccggatcaaggac
gccatcgccgtacggcacgaggagatcgcgcggtccatcagcgcgcagaacggctccccc
tactcgtggagcgtcctcgcccaggcgctcggcgcgatgatggtgtgggactcggcgatc
tccgtcgcccgcgacttcacgcacgaggaacggcgcgacggtgtcctcggcccgatcctg
gtgcggcgcgagccggtgggcgtcgtcgcggccgtcgtgccgtggaacgtcccgcagttc
accgctgccgccaagctcgcccccgcgctgctcgcgggctgcaccgtcgtcctcaagccc
tcgccggagacacccctcgactcgtacatcctcggcgagatcgcgcgggaggccgggctg
ccggagggagtcctgtcgatcctgcccgcgggccgggaggtcagcgagtacctggtcggg
cacaagggcgtcgacaaggtctccttcaccggttccgtcgaggccggccgccgggtcatg
gaggtcgcctcgcgcaacctcacccgcgtcaccctcgaactcggcggcaagtcggcggcg
gtgatcctgcccgacgccgacctcgccaccgcggtcgccgggatcgtcccggccgcctgg
atgaacaacggccaggcctgcgtggcccagacccgcatcctcgcgccgcgcagccgctac
gacgagatcgcggaggccttcgccgccgcggcgtccgcgctcgtcgtcggcgaccccctc
gacgcggccacccaggtcggcccgttggtcgcggagcgccagcggcggcgttcgctggac
tacatacgtatcgggcaggaggagggcgccaagatcctctgcgggggcggccgtccggcc
ggcctggagcgcggctggtacgtggagccgacgctcttcggaggcgtcgacaactcgatg
cgcatcgcccgcgaggagatcttcggcccggtgatctgcctgctgccgtacggcgacgag
gacgaggccgccgcgatcgccgacgactccgactacggcctcagcggcagtgtgtggacg
tccgacgtcgagcacggcatcgacttcgcgcggcgggtgcggaccggcacgtacaacgtc
aacaccttcagtctcgacatgctcggtcccttcggcggctacaagaacagcggcgtgggc
cgggagttcggaccggagggctacggcgaattcctcgagcacaagatgatccacctgccc
gccggacacgggagccactga

DBGET integrated database retrieval system