KEGG   Streptomyces pristinaespiralis: SPRI_6322Help
Entry
SPRI_6322         CDS       T04073                                 

Definition
(GenBank) neuramidase
  KO
K01186  sialidase-1 [EC:3.2.1.18]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00511  Other glycan degradation
spri00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SPRI_6322
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPRI_6322
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:spri02042]
    SPRI_6322
Enzymes [BR:spri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.18  exo-alpha-sialidase
     SPRI_6322
Bacterial toxins [BR:spri02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   SPRI_6322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BNR_2 NPCBM_assoc BNR_3 BNR Sortilin-Vps10
Motif
Other DBs
NCBI-ProteinID: ALC24628
UniProt: A0A0M4DBA4
LinkDB All DBs
Position
complement(7300524..7301990)
Genome map
AA seq 488 aa AA seqDB search
MQRRMSLAVLSAAMVVLSTTGVAHGAEQPVQGQLYSQDIATQGVGSPYYRIPALTKTNAG
TLLAAYDARPTLADLPGNLSVVLRRSTDDGVTWQAQQVVRKEAAPKGFGDPSLLVDRETG
RIFVFYAASVNQGFFGSATGNDENDPNVLQADYSYSDDDGLTWKHERITAEIKNPAWAGM
FAASGEGIQLRHGTYKGRLIQQYAIRNNNANYAVSAYSDDHGATWKMGNPVGPGGDENKT
VELSDGRIMLNNRSAPYRTVAYSTDGGVNYTPFQQDTELPDPANNGSVMRFAPNVDASHP
RAKWLMFSNTATTNSRSNLTVRLSCDNGQNWPVRKVVNAGSSAYSTLTPLTDGTGGNPRT
GLLWERDNYRHITYSSFDLQWLGGVCAPVTVTPPASLPAGRTTEVTVRVVSQNDVTLPGG
SVSLSLPAGWSAPTVAVPALNPGQGANMKIPVTVPASAAAGKVPATATYLVRGWQRSHGE
TSLTVTAP
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcagaatgtctctcgccgtgctgtccgcagcgatggtcgtactgagcaccacc
ggcgtggcccacggcgccgagcagcccgtgcagggccagttgtactcccaggacatcgcc
acccagggtgtcggctcgccctactaccgcatccccgccctgacgaagacgaacgcgggc
accctcctcgccgcgtacgacgcccggcccaccctcgcggacctgcccggcaacctctcc
gtggtgctgcggcgcagcaccgacgacggtgtgacctggcaggcgcagcaggtcgtccgc
aaggaggccgcgcccaagggcttcggcgacccgagcctgctcgtggaccgggagacgggg
cgcatcttcgtcttctacgcggcctccgtgaaccagggcttcttcggctcggcgaccggc
aacgacgagaacgacccgaacgtgctccaggccgactacagctactcggacgacgacggg
ctcacctggaagcacgagcggatcaccgccgagatcaagaacccggcctgggcggggatg
ttcgccgcctccggcgagggtatccagctgcggcacggcacctacaagggccggctgatc
cagcagtacgccatccgcaacaacaacgccaactacgcggtgagcgcctacagcgacgac
cacggcgccacctggaagatgggcaaccccgtcggccccggcggcgacgagaacaagacc
gtggagctctccgacgggcgcatcatgctcaacaaccgctccgcgccctaccgtacggtc
gcctactcgacggacggcggcgtcaactacacgccgttccagcaggacaccgagctgccc
gacccggcgaacaacggctcggtcatgcgcttcgcgccgaacgtcgacgcgagccacccg
cgcgcgaagtggctgatgttcagcaacaccgccaccaccaacagccgcagcaacctgacg
gtccgtctgtcgtgcgacaacggacagaactggcccgtcaggaaggtggtgaacgcgggc
tcctccgcgtactcgacgctgacgccgctcaccgacggcaccggcggcaacccgaggacg
ggtctgctgtgggagcgggacaactaccgccacatcacctactcgtcgttcgacctccag
tggctcggcggcgtgtgcgcgccggtcacggtcacgcctccggcttcgctgccggccggg
aggaccaccgaggtcaccgtgcgggtcgtcagccagaacgacgtgacgctgcccggcggt
tcggtgtcgctgagcctgcccgcgggctggagcgcgcccacggtggcggtgcccgcgctc
aaccccggccagggcgcgaacatgaagatcccggtcaccgtcccggcgagcgccgccgcg
ggcaaggtgccggccacggcgacgtacctggtgcgcggctggcagcggtcgcacggggag
acctccctgacggtcaccgctccctga

DBGET integrated database retrieval system