KEGG   Streptomyces pristinaespiralis: SPRI_6571Help
Entry
SPRI_6571         CDS       T04073                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
spri  Streptomyces pristinaespiralis
Brite
KEGG Orthology (KO) [BR:spri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPRI_6571
Enzymes [BR:spri01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPRI_6571
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_42C Glyco_hydro_35 Glyco_hydro_14 DUF4159 DUF4350 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: ALC24877
UniProt: A0A0M4DGA4
LinkDB All DBs
Position
7574985..7577006
Genome map
AA seq 673 aa AA seqDB search
MPETTPQGPDRLAFGGDYNPEQWPESVWHEDVRLMREAGVTMVSVGIFSWALLEPEPGGY
DFGWLDRVLDLLHENGIRADLGTPTASPPAWFYRAHPDALPVGREGLRHSFGSRAAICHS
SPAYREAAARITTELGRRYAGHPALAMWHVHNEYGVPVSACYCDNCAAHFRRWLQARYGT
VEAVNDAWGTAFWGLRYRSFDEIDPPRLTPTVGNPAQQLDHRRFADDTMRENFRMERDIL
HRLAPGVPVTTNFMTALSQCDTIDYWAWGREVDLVTNDHYLMTDGRRTHVNLAMAADLTR
SVAGGAPWLLLEHSTSGVSWQPRNPAKRPGEMARNSLAHVARGSEGAMFFQWRQSRKGAE
KFHSAMLPHAGTDTRIWREVVALGADIGSLAGLRGTRTVPDVGMVWDWHSWWAQGLEWRP
SEDHDARERADSFYEALYDRHLTVDFAHPGADLSAYPLVVVPALYLATEESGRNLRAYVE
NGGTLVVSYFSGIVDEHDAVHPGAYPGVLRDVLGLTVEEWSPLGAGESVRITGPQDATVT
GDVWTEFVVPRGAETVWTYADGPAAGGPAVTRHRLGRGTAWYVSSRLDPLALDAVLESAC
EDAGIAPRTELPRDVEVVRRCGDGGDYLFAVNHTPHDTKVPLERPGTELLSGEHAAGHLA
VPAGAVKVVRLDA
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atgccggagaccactccccaggggccggaccggctcgcgttcggtggggactacaacccc
gagcagtggccggaaagcgtctggcacgaggacgtccggctgatgcgcgaggccggggtc
accatggtgagcgtcgggatcttctcctgggcgctgctcgaacccgagcccggcggctac
gacttcggctggctcgaccgggtcctcgacctgctccacgagaacggcatccgcgccgac
ctcggcacgcccaccgcctccccgccggcctggttctaccgggcccacccggacgcgctg
cccgtcggccgggaggggctgcgccactccttcggctcgcgtgccgcgatctgccacagc
agccccgcctaccgcgaggccgccgcacggatcaccaccgaactcggccggcggtacgcc
ggccaccccgccctcgccatgtggcacgtccacaacgagtacggcgttcctgtcagcgcg
tgctactgcgacaactgcgccgcgcacttccgccgctggctgcaggcccgctacggaacg
gtcgaggcggtcaacgacgcctggggaaccgccttctggggcctgcgctaccggtcgttc
gacgagatcgacccgccgcggctgaccccgacggtcggcaaccccgcccagcagctcgac
caccgccgcttcgccgacgacaccatgcgcgagaacttccgcatggagcgggacatcctg
caccggctcgcgcccggcgtccccgtcaccaccaacttcatgaccgcgctcagccagtgc
gacacgatcgactactgggcctggggccgcgaggtcgacctcgtcaccaacgaccactat
ctgatgaccgacggccgccgcacccacgtcaacctggcgatggccgccgacctcacgcgc
tccgtcgccggcggcgccccctggctgctgctcgagcactccaccagtggcgtcagctgg
cagccgcgcaaccccgccaagcgccccggagagatggcccgcaactcgctcgcccatgtg
gcccgcggctccgagggcgccatgttcttccagtggcgccagtcccggaagggcgccgag
aagttccactccgcgatgctgccgcacgccgggaccgacacccggatctggcgcgaggtg
gtcgcgctcggggccgacatcggctcgctcgccgggctgcgggggacccgtaccgtcccc
gacgtcggcatggtgtgggactggcactcgtggtgggcgcagggcctcgaatggcggccc
agcgaggaccacgacgcccgcgagcgtgccgacagcttctacgaggcgctctacgaccgg
cacctgaccgtcgacttcgcccaccccggagccgacctgtccgcctaccccctggtcgtc
gtcccggccctctatctcgccaccgaggaatcgggccgcaatctgcgcgcctatgtcgag
aacggcggcaccctcgtcgtctcgtacttctccggcatcgtcgacgagcacgacgccgtg
caccccggcgcctacccgggtgtgctgcgcgacgtgctcggcctgaccgtcgaggagtgg
tcaccgctcggggcgggcgagagcgtgcggatcaccgggccgcaggacgccacggtcacc
ggcgacgtgtggaccgagttcgtggtgccgcgaggggccgagacggtgtggacgtacgcc
gacggaccggccgcgggcggccccgccgtcacccgtcaccgcctgggcaggggcaccgcc
tggtacgtctcctcccggctcgaccccctcgcgctggacgccgtcctcgagagcgcctgc
gaggacgccggcatcgcaccccggaccgaactgccccgcgacgtcgaggtggtacgccgc
tgcggcgacggcggcgactacctcttcgccgtcaaccacaccccgcacgacaccaaggtt
cccctcgagcgccccggcaccgaactgctcagcggcgagcacgccgccggacacctcgcc
gtcccggccggcgccgtcaaggtcgtacggcttgacgcctga

DBGET integrated database retrieval system