KEGG   Streptomyces pristinaespiralis: SPRI_6582Help
Entry
SPRI_6582         CDS       T04073                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
spri  Streptomyces pristinaespiralis
Pathway
spri00010  Glycolysis / Gluconeogenesis
spri00052  Galactose metabolism
spri01100  Metabolic pathways
spri01110  Biosynthesis of secondary metabolites
spri01120  Microbial metabolism in diverse environments
spri01130  Biosynthesis of antibiotics
Module
spri_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:spri00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPRI_6582
   00052 Galactose metabolism
    SPRI_6582
Enzymes [BR:spri01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     SPRI_6582
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim PsbQ
Motif
Other DBs
NCBI-ProteinID: ALC24888
UniProt: A0A0M4DI27
LinkDB All DBs
Position
7593889..7595073
Genome map
AA seq 394 aa AA seqDB search
MTTSRRAVLTAAAAAAATAATAATTPAAAAGTTTAPRGTRQARGPVRQRFGSLADGTAVD
LWTLENEGIRLRVLSYGGIVQGLEVPDRRGRWANVSLGFGNLDDYVAKSPYFGAVIGRYG
NRIAGGRFTLDGTTHRLPANDGPNSLHGGDQGFDKRVWDVEPFRRGTDTGLTLRRVSPHG
EMGYPGTLTVRVDYTLTARGEFRVDYEATTDRATVVNLTNHTYFNLAGEGSGTVHDHRLR
IDASRYTPVDATLIPTGVLARVARSPFDFRLGKPIGEDLRQGHEQILLGQGYDHNFVLDK
GITAQPRKAVTVTEPTSGRVMTIATTEPGLQFYSGNFLDGTLKGTSGRVYRQGDGFCLET
QHFPDSPNRPEFPTTVLRPGQVYRSSTVHSFGTL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgacgaccagcagacgtgccgtgctgacggcggcggcggcagccgcggcgacagcggcc
accgcggcgacgaccccggccgcggccgccggcaccacgacggccccgagggggacccgg
caagcccgcggccccgtccggcagcggttcgggtccctggccgacggcaccgccgtcgac
ctgtggacgctggagaacgagggcatccgtctgcgcgtcctgtcgtacggcggaatcgtc
caggggctggaggttcccgaccgccgggggcggtgggcgaacgtgtccctcggcttcggc
aacctggacgactacgtggcgaagagcccgtacttcggcgcggtgatcggccgttacggc
aaccgcattgccggcggcaggttcacgctggacgggaccacccaccggcttccggcgaac
gacggccccaacagcctgcacggcggcgaccagggcttcgacaaacgggtctgggacgtc
gagccgttccgccggggcaccgacaccggcctcaccctgcggcgcgtcagcccgcacggc
gagatgggataccccggcaccctcaccgtccgggtcgactacaccctcaccgctcgcggc
gagttccgcgtcgactacgaggcgacgacggaccgcgccacggtcgtgaacctcaccaac
cacacctacttcaacctcgcgggcgaggggagcggcaccgttcacgaccaccggctgcgc
atcgacgcctcccgctacacgccggtggacgccacactgatcccgacgggcgtcctggcc
cgcgtcgcccgcagccccttcgacttccggctgggcaagccgatcggcgaggacctccgc
caagggcacgagcagatcctcctggggcaggggtacgaccacaacttcgtgctcgacaag
gggatcaccgcgcagccgcggaaggccgtcacggtcaccgagcccacgtcggggcgggtc
atgaccatcgccaccacggagccgggtctgcagttctacagcggcaacttcctcgacggc
accctgaagggcacctccggccgggtgtaccggcagggcgacgggttctgcctggagacc
cagcacttccccgactcgcccaaccggcccgagttcccgaccacggtgctccggcccggg
caggtgtaccggtcctcgaccgtgcactccttcggcacgctctga

DBGET integrated database retrieval system