KEGG   Spiroplasma sp. NBRC 100390: S100390_v1c08560Help
Entry
S100390_v1c08560  CDS       T05859                                 

Gene name
prkC
Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sprn  Spiroplasma sp. NBRC 100390
Brite
KEGG Orthology (KO) [BR:sprn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sprn01001]
    S100390_v1c08560 (prkC)
Enzymes [BR:sprn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     S100390_v1c08560 (prkC)
Protein kinases [BR:sprn01001]
 Serine/threonine kinases: Other
  Bacterial family
   S100390_v1c08560 (prkC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Haspin_kinase RIO1 Kinase-like
Motif
Other DBs
NCBI-ProteinID: APE13662
UniProt: A0A1J0U1K2
LinkDB All DBs
Position
complement(974586..975599)
Genome map
AA seq 337 aa AA seqDB search
MEQITVGTMLYNRYQILAKIADGGMAEVFEGYDTLLKRYVAIKIMALSLSKNKEAVDRFN
KEYNSIAQFSHKNVVKVYGSFEAYDRHCLVLELVKGYTLKDRLLTLGPCTVKELLYFFDE
INLAITEAHQNDIIHRDIKPENILISYDGKIKVADFGVAILENSEDLESGKIIGTSKYMA
PEIVQSRPASRRSDIYALGIMLYELAVGMAPFVGKNPTFVAVKHVKELPLRPRLINPALP
QSLENVILKAIAKDPTERFQTVAEFNVSLQAVENPEHQHDKPLKLRNYLEVKGKRGKVQD
RYYSYPRFLRIKVAFWLILLLVAFLTAMICLCLLFPR
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaacaaattacagttggaactatgttatataatcgttatcagattttagctaaaatt
gccgacgggggaatggccgaggtttttgaaggatatgatacgttattaaagcgatatgtt
gcgattaaaattatggctttatcgttatcaaaaaataaggaagctgttgatcgttttaat
aaagaatacaattctattgcccaattttcccacaaaaatgttgttaaggtttatgggtct
tttgaagcttatgatcggcattgtttagtgttagaattagtaaaaggttatactttaaaa
gaccgtttattaacattagggccttgtaccgttaaagaactgttatatttttttgatgaa
attaatttagctattactgaagcgcatcaaaatgatattattcatcgggatattaaacca
gaaaatattttaatttcatatgatggcaaaattaaagttgctgattttggggtagcaatt
ttagaaaatagtgaggacttagaatcgggcaaaattattggaacatcaaaatatatggcc
ccagaaattgtgcaatcaagaccagctagtcgtcggagtgatatttatgccttagggatt
atgctgtatgaattagcggttggaatggccccctttgttggtaaaaatccaacttttgtt
gccgtaaaacatgttaaagaattacctttacgtccccgcttgataaatccagcattacca
caaagtttagaaaatgtgattttaaaggctattgcaaaagatccaacagaacggtttcaa
acggttgctgaatttaatgttagtttacaagcagttgaaaatcctgagcaccaacatgat
aaaccattaaaattgcgtaattaccttgaagtcaaaggaaaacggggtaaagttcaagac
cgttattattcttatccgcggtttttacgaattaaagttgctttttgattaattttatta
cttgtcgcattcttaacagcaatgatatgtctttgcttgttatttccgaggtag

DBGET integrated database retrieval system