KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0321Help
Entry
SPs0321           CDS       T00119                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Pathway
sps00220  Arginine biosynthesis
sps00250  Alanine, aspartate and glutamate metabolism
sps00290  Valine, leucine and isoleucine biosynthesis
sps01100  Metabolic pathways
sps01110  Biosynthesis of secondary metabolites
sps01130  Biosynthesis of antibiotics
sps01210  2-Oxocarboxylic acid metabolism
sps01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPs0321
   00290 Valine, leucine and isoleucine biosynthesis
    SPs0321
   00220 Arginine biosynthesis
    SPs0321
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sps01007]
    SPs0321
Enzymes [BR:sps01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SPs0321
    2.6.1.66  valine---pyruvate transaminase
     SPs0321
Amino acid related enzymes [BR:sps01007]
 Aminotransferase (transaminase)
  Class I
   SPs0321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: BAC63416
LinkDB All DBs
Position
360707..361945
Genome map
AA seq 412 aa AA seqDB search
MEYEVYETMKIIEKSSKLEHVAYDIRGPVLDEANRMIASGEKILRLNTGNPAAFGFEAPD
EVIRDLIVNARLSEGYSDSKGIFSARKAIMQYCQLKGFPDVDIEDIYLGNGVSELISISL
QALLDNGDEVLVPMPDYPLWTACVSLGGGKAVHYLCDEEAGWYPDIADIKSKITSRTKAI
VVINPNNPTGALYPKEILEDIVALAREHQLIIFADEIYDRLVMDGKEHIAIASLAPDVFC
VSMNGLSKSHRIAGFRVGWMVLSGPKDHVKGYIEGLNMLANMRLCSNVLAQQVVQTSLGG
HQSVDALLLPGGRIFEQRNFIYEAINAIPGLSAVKPEAGLYLFPKIDRQMYRIDDDEEFV
LQLLKQEKVMLVHGRGFNWKDPDHFRIVYLPSVEELEDVQEKITRVLYQYRR
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggaatacgaggtgtatgagactatgaaaattattgaaaaatcatcaaaattagaacat
gttgcctatgatattcgagggcctgttttggatgaagctaatcgcatgattgcgagtggt
gaaaaaattctgcgtttaaatactggcaatcctgctgcttttggttttgaagcaccagat
gaagtgattcgtgatttaattgtcaacgcgaggctaagtgagggctattctgacagtaaa
gggattttttcagcgcgtaaggctatcatgcagtattgtcaactcaagggcttcccagat
gttgacattgaagatatttatttgggaaatggcgtgtcagagttgatatccatatccctt
caagctttgctagataatggcgatgaagttttagtaccaatgccggattatcctttatgg
acggcttgtgtgagtcttggtggaggaaaagcggtccattatctttgtgatgaagaagct
ggttggtatcctgatattgctgatatcaaatcaaaaatcacgagtcgcaccaaagctatt
gtggtcatcaatcctaataacccaacaggagccctttatcctaaggagattttagaagac
atcgttgctttggcaagagaacaccagctgattatttttgccgatgaaatctatgatcgt
ttggtgatggatggtaaagagcatattgctattgcaagtttggcacctgatgttttttgt
gtatctatgaatggtctttccaaatctcatcgtattgctggttttcgtgttggatggatg
gtcttatcaggtcctaaagaccatgttaaaggttacattgaagggttaaacatgcttgcc
aatatgcggttatgctccaatgttttagcccaacaagttgttcaaacttccttaggaggt
catcaatcagttgatgcactgttactgccaggagggcgtatttttgagcaacgtaatttt
atttatgaagctattaatgctatccctggcttatcggcagttaaacctgaagcaggtctt
tatttatttccgaaaattgatcgtcagatgtatcgtattgatgatgatgaagaatttgtc
ttacagttattaaagcaagaaaaagtgatgttggtacatggacgtggttttaactggaaa
gatccagatcacttccgtattgtttacctaccaagtgtagaagaattagaagatgtccaa
gaaaagattacacgtgtcttataccagtatagacgttaa

DBGET integrated database retrieval system