KEGG   Streptococcus pyogenes SSI-1 (serotype M3): SPs0792Help
Entry
SPs0792           CDS       T00119                                 

Definition
(GenBank) putative superoxide dismutase (Fe/Mn)
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sps  Streptococcus pyogenes SSI-1 (serotype M3)
Brite
Enzymes [BR:sps01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPs0792
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAC63887
UniProt: P0DF73
LinkDB All DBs
Position
782908..783513
Genome map
AA seq 201 aa AA seqDB search
MAIILPELPYAYDALEPQFDAETMTLHHDKHHATYVANTNAALEKHPEIGENLEELLADV
TKIPEDIRQALINNGGGHLNHALFWELLSPEKQDVTSDVAQAIDDAFGSFDAFKEQFTAA
ATGRFGSGWAWLVVNKEGQLEITSTANQDTPISEGKKPILALDVWEHAYYLNYRNVRPNY
IKAFFEIINWKKVSELYQAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccagaacttccatacgcgtatgatgctcttgaaccacagtttgat
gcggagacaatgactcttcatcatgataaacaccatgccacttatgtcgctaataccaat
gcggctttagaaaaacacccagagatcggagaaaatctggaggaactattggcagatgtc
actaagattccagaagatattcgtcaagccttaattaataatggtggaggacacctaaac
catgcgcttttctgggaactattatcacctgaaaaacaagacgtcacttctgatgttgca
caagccattgatgatgcttttgggtcatttgacgcctttaaagaacaatttacagcagct
gctactggacgttttggttcaggttgggcatggttagttgttaataaagaaggacaactc
gaaatcacatcaaccgctaaccaagatactccaatttcagaaggcaaaaaaccaattcta
gcgcttgatgtgtgggagcatgcttactacttgaattatcgtaatgtacgtccaaattat
atcaaagctttctttgaaatcattaattggaaaaaagtatcagaactttaccaagccgct
aaataa

DBGET integrated database retrieval system