KEGG   Sphingobacterium psychroaquaticum: E2P86_01545Help
Entry
E2P86_01545       CDS       T05967                                 

Gene name
nrdF
Definition
(GenBank) class 1b ribonucleoside-diphosphate reductase subunit beta
  KO
K00526  ribonucleoside-diphosphate reductase beta chain [EC:1.17.4.1]
Organism
spsc  Sphingobacterium psychroaquaticum
Pathway
spsc00230  Purine metabolism
spsc00240  Pyrimidine metabolism
spsc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spsc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    E2P86_01545 (nrdF)
   00240 Pyrimidine metabolism
    E2P86_01545 (nrdF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spsc03400]
    E2P86_01545 (nrdF)
Enzymes [BR:spsc01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     E2P86_01545 (nrdF)
DNA repair and recombination proteins [BR:spsc03400]
 Prokaryotic Type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    E2P86_01545 (nrdF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribonuc_red_sm RuvX
Motif
Other DBs
NCBI-ProteinID: QBQ39903
LinkDB All DBs
Position
complement(363616..364602)
Genome map
AA seq 328 aa AA seqDB search
MSKQFKAVNWNTPDNDYVLMFWEQNIRQFWIDTEYIPSKDIDSWKGLSWDMKECYKKALG
GLTLLDTLQSHTGMPKIIDHIDSLQNKAVLSYMCMMEAIHAKSYSTIFTTVSTTNEINDV
FGWVKENKFLQYKASTIDKYYRAIDKEQVNDEELFMALAASVLLESFLFYSGFFLPLWLC
GQGQMVASADIIKKIIADESIHGVFVGLIAQEVYSRLSNKEEVKARFMNLLNDLYENEIK
YTEELYTVVGLTAEVKEYVRYNGNKALMNLGFDPIFEVKQVNPIVLNGLNTETTQHDFFS
KKSTNYEKSMEIVHLMDDDFKMDALVEI
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaacaatttaaagctgtaaactggaacaccccggacaacgattatgtcttgatg
ttctgggagcagaatataagacaattctggattgacacagaatatattccttctaaggat
atcgatagctggaaaggcttgagctgggatatgaaggagtgttacaagaaagctttgggc
ggattgacactgttggataccctacaaagccacacgggtatgccgaaaattatcgaccat
atcgactctttacagaataaagcagttctttcgtacatgtgtatgatggaggctatccat
gctaaatcatattcaacgatctttacgacggtatctactacgaatgagatcaatgatgtg
tttggatgggtgaaggaaaacaaattcttgcaatacaaagcttctacgatagataaatat
taccgtgcgattgataaagagcaagtaaacgatgaggaattgtttatggcacttgcagca
tcggttttattagagtctttcttgttttactctggatttttcttgcctttatggttatgt
ggacaaggacagatggtagcctctgcggatattatcaagaagattattgccgatgagtct
atccatggtgtattcgtaggattgatcgcacaagaggtatatagccgcctatccaacaaa
gaagaagtaaaggctcgtttcatgaacttgttaaacgacttgtacgaaaatgaaattaaa
tataccgaagaattatatactgttgtaggcttaacagctgaagtgaaagaatacgtacgc
tacaacggtaacaaagctttaatgaatttaggctttgatccaatcttcgaagtaaagcaa
gtaaacccaattgtattgaacggtctaaacaccgaaacaacacaacatgatttcttctcg
aagaaatcaacaaactatgaaaaatccatggaaattgtccacctaatggatgacgacttt
aaaatggatgctttggtagagatttaa

DBGET integrated database retrieval system