KEGG   Sphingobacterium psychroaquaticum: E2P86_01620Help
Entry
E2P86_01620       CDS       T05967                                 

Gene name
ilvD
Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
spsc  Sphingobacterium psychroaquaticum
Pathway
spsc00290  Valine, leucine and isoleucine biosynthesis
spsc00770  Pantothenate and CoA biosynthesis
spsc01100  Metabolic pathways
spsc01110  Biosynthesis of secondary metabolites
spsc01130  Biosynthesis of antibiotics
spsc01210  2-Oxocarboxylic acid metabolism
spsc01230  Biosynthesis of amino acids
Module
spsc_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
spsc_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:spsc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    E2P86_01620 (ilvD)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    E2P86_01620 (ilvD)
Enzymes [BR:spsc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     E2P86_01620 (ilvD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: QBQ39918
LinkDB All DBs
Position
complement(381968..383668)
Genome map
AA seq 566 aa AA seqDB search
MKSSSDQGNALNKYSRIFTQDETQPAAKAMLYGIGLTDADMDKGQVGIASMGYDGNTCNM
HLNDLAQVVKKGVWEHDLVGLTFGTIGVSDGMSNGTDGMRYSLVSRDVIADSIETICGGQ
YYDGLIAIPGCDKNMPGAIMAMGRLDRPAIMVYGGTIAPGHYKGQELNIVSAFEALGQRV
CGNLSDEDYEGIIKHTCPGAGACGGMYTANTMASAIEALGMSLPYSSSNPAISAEKKAEC
LDAGKYIRVLLERDIKPSDIMTRKAFENAIRAIIILGGSTNAVLHFIAIGKSVGVDITQD
DFQKMSDETPVLADFKPSGKYLMQDLQQYGGTPAVLRYLLDQGLLHGDCLTVTGKTMAEN
LADVKSIMDYNQPIIKPLENPIKATGHLQILYGNLAEKGSVAKISGKEGEKFTGPARVFD
GEHELVAGVSSGRIKPGDVIVIKNAGPIGAPGMPEMLKPTSLIIGAGLGNSVALITDGRF
SGGTHGFVVGHITPEAYAGGLIGLVEDDDVIEIDAVNNKLNLQVDEETIAKRRANYVQPA
LKVTKGVLYKYAKTVADASEGCVTDL
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcatcatctgaccaaggaaacgccttaaacaagtacagtagaatctttacgcaa
gatgaaacccaacccgctgccaaagccatgctttacggcatcggccttaccgacgccgac
atggataaagggcaggtcggtattgccagcatgggttatgatgggaatacctgcaacatg
cacctgaatgatttggcgcaagtcgtcaaaaaaggcgtctgggagcatgatctggtcggc
ttgactttcggtacgatcggtgtcagcgatggtatgagcaacggaacagacggcatgcgc
tactctttagtgtcccgcgatgttatcgcagacagtatcgagaccatttgcggcggacaa
tactacgacggtttaattgcgatccctggttgtgacaagaatatgccgggcgctattatg
gcgatgggacgtttagatcgtccagctattatggtatacggcggcacaattgcaccagga
cactataaagggcaagaacttaatatagtatctgcttttgaagcattaggtcaacgcgta
tgcggaaacctttcggatgaagactacgaagggatcattaagcacacctgccctggcgct
ggcgcttgtggaggtatgtacactgctaatactatggcttctgctattgaagcactgggc
atgagccttccctactcgtcgtccaacccggctatctcagcagagaaaaaagcagagtgt
ttagatgctggaaaatatatccgcgttctattggagcgcgatatcaaaccttcagatatc
atgacacgcaaagcttttgaaaatgctattcgtgctattatcatactaggaggaagtacc
aatgcggttcttcactttattgccatcggtaaatctgtaggcgtagacatcacacaggat
gatttccaaaaaatgtcggacgaaacaccagtgctagccgacttcaaaccatccggtaaa
tacttgatgcaagacttacaacaatacggcgggacacctgcagttttacgttacttgctt
gatcaaggcttattacatggcgattgtctaacggtaacaggaaagacaatggcagaaaac
ctggcggatgttaaatcgatcatggactacaaccaacctatcataaagccccttgagaat
cctatcaaagcaacagggcatctgcagatcctttacggcaatttagccgaaaaggggtct
gtggcgaaaatctcgggtaaagaaggagagaaattcaccggaccagcacgcgtatttgat
ggcgagcatgaacttgtagctggcgtatcgtcaggacgtatcaaaccgggcgatgtaatc
gtgattaaaaatgccggacctatcggtgccccaggtatgccggaaatgttaaaaccgaca
tccctaatcatcggtgcaggcttaggcaattctgtcgcactaatcaccgatggaaggttc
tctggtggtacacatggctttgtggttggacacatcacaccagaggcatatgccggtggt
ctaatcggcttggttgaagacgatgacgtcattgaaatcgatgcagtcaacaacaaactc
aacttgcaggtggatgaagaaaccatcgctaaacgtcgcgcgaactatgtacaaccagcg
ttaaaagtaaccaagggtgttttatataaatatgccaaaacggttgctgacgcttcagaa
ggctgcgtaacggatctataa

DBGET integrated database retrieval system