KEGG   Sphingobacterium psychroaquaticum: E2P86_02025Help
Entry
E2P86_02025       CDS       T05967                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
spsc  Sphingobacterium psychroaquaticum
Pathway
spsc00010  Glycolysis / Gluconeogenesis
spsc00020  Citrate cycle (TCA cycle)
spsc00620  Pyruvate metabolism
spsc01100  Metabolic pathways
spsc01110  Biosynthesis of secondary metabolites
spsc01120  Microbial metabolism in diverse environments
spsc01130  Biosynthesis of antibiotics
spsc01200  Carbon metabolism
Module
spsc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:spsc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    E2P86_02025
   00020 Citrate cycle (TCA cycle)
    E2P86_02025
   00620 Pyruvate metabolism
    E2P86_02025
Enzymes [BR:spsc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     E2P86_02025
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H DUF2118 PYNP_C Peptidase_C25_C
Motif
Other DBs
NCBI-ProteinID: QBQ39990
LinkDB All DBs
Position
501536..503170
Genome map
AA seq 544 aa AA seqDB search
MAEVVRMPKMSDTMTEGVIAKWHKKVGDKVNSGDLIAEVETDKATMDFESYQEGTLLYIG
PKEGEAVAIDAVIAVLGEEGEDYKALLEGDAAPAKAEEKSEAAAEPADAPAASTSTVTPE
DLGCTVITMPLLSDTMTEGVIAQWNFKVGDTIKSDDAIADVETDKATMEVTAYAEGTLLY
VGLEAGEAAKVNDIIAIVGPAGTDITPLLNQKPSAPAAAKAETAAPAVAETTSAAAPVAA
ATSTADDSRVKASPLARKIAKERGINLNDVKGSADGGRIVKKDVETFVPTAAAAKADAPA
AAASEGKATISLPQVIGEEKYTEVAVSQMRKTIARRLGESLFTAPHFYLTISVDMDNAIA
ARAQINEVAPVKVSFNDILIKAVASALKQHPAVNSSWRGDKIRFNQHVNIGVAMAVEDGL
LVPVVRFADGKSLSHISAEVKEYGQKAKAKKLTPADWEGSTFTISNLGMFGIDEFTSIIN
SPDGAIISVGAIQQIPVVKNGAVVPGNVMKLTMGCDHRVVDGATGAAFLQTVKSLLEAPI
RLLA
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atggctgaagtagtaagaatgccgaaaatgagcgacaccatgaccgaaggtgtaattgct
aaatggcacaaaaaagtcggtgataaagtaaactccggtgatttaattgctgaagttgaa
acagataaagcaacgatggacttcgagtcttatcaagaaggaacattgttgtacattggc
ccgaaggaaggtgaagctgtagcaattgatgcggtaatcgctgttttgggtgaagaaggg
gaggattacaaagctttgctagaaggtgatgctgctccagctaaggcggaagagaaatct
gaagcagcagctgagcctgctgatgctcctgcggcaagtacatctaccgttacgcctgag
gatttaggttgtaccgtaattacgatgccattgttgagtgataccatgactgaaggggtt
attgcacaatggaactttaaagtgggtgataccataaaatcagatgatgctatcgctgat
gttgagacggacaaagcaacaatggaggttactgcttatgcagaaggaacattgttatat
gttggtttggaagcaggtgaagcagcaaaagtaaatgatattattgctattgtaggtcct
gcgggaacagatattacgccattgttgaatcaaaagcctagtgcaccagcagcagcgaaa
gctgaaacggcagcgcctgcggtcgcagaaacaactagcgcagcagcgccagtagcagca
gcgacgagcacagcggatgattcacgtgtgaaagcttctcctttagcaagaaaaattgcg
aaagaacgtggcattaatctgaacgatgtgaaagggtctgcggatggcggtcgtattgtg
aagaaagatgtagaaacatttgttccgacagcggcggcggcaaaagcagatgctccagcg
gcagcagcgagcgaaggaaaagcaacgatttctttaccacaagttattggagaagagaaa
tatacagaagtagcggtttcgcaaatgcgtaaaactattgcacgtcgcttaggtgaatct
ttatttactgcaccacatttctatttgaccatctctgttgatatggacaatgcgattgct
gcgcgtgcacagattaatgaggtagcgcctgttaaggtttctttcaatgatatcttaatt
aaagcagttgcttctgcattaaaacaacatcctgcggtgaactcttcatggagaggggat
aagattcgtttcaaccaacacgtaaatattggagtggcgatggctgtggaagatggtcta
ttggttccggtagtacgttttgcagatggtaaatccttatcgcacatctctgcagaagtt
aaagaatacggacaaaaagcaaaagctaagaaattaacaccagcagattgggaaggttca
acatttacaatctctaacttaggtatgtttggtattgatgagtttacatcaatcatcaac
tcaccggatggtgcaatcatttctgtcggcgcgatccagcagattccagttgttaaaaat
ggagctgtagtaccaggtaatgttatgaaattaactatgggatgtgaccaccgtgtggtg
gatggtgcaactggtgctgctttcttgcaaaccgtaaaatcattactagaagcgccaatt
cgtttattagcgtaa

DBGET integrated database retrieval system