KEGG   Sulfitobacter pseudonitzschiae: SULPSESMR1_02373Help
Entry
SULPSESMR1_02373  CDS       T04974                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
spse  Sulfitobacter pseudonitzschiae
Pathway
spse00240  Pyrimidine metabolism
spse01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spse00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    SULPSESMR1_02373 (tdk)
Enzymes [BR:spse01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SULPSESMR1_02373 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 AAA_30 AAA_14
Motif
Other DBs
NCBI-ProteinID: ASM73170
UniProt: A0A221K2R6
LinkDB All DBs
Position
2419015..2419599
Genome map
AA seq 194 aa AA seqDB search
MAKLYFHYSTMNAGKSTVLLQAAHNYRERGMQCYLLTAQFDNRAGQGRIASRIGIGQDAD
TFGPGEDLFAKIQTQLATAQIACIFIDEAQFLSDAQVWQLARAVDDLKVPIMCYGLRVDF
QGKLFPGSATLLALADEMREVRTICHCGKKASMVVRQDAQGNVVKDGAQVQIGGNETYVS
LCRRHWRKATGDIA
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctctatttccactactcgacaatgaacgcaggcaaatcgacagtgcttttg
caggccgcgcacaactatcgtgaacggggaatgcaatgctacctgctgaccgcgcaattc
gacaaccgcgcaggtcagggccgtatcgccagccggatcggcattggtcaggatgcagac
acattcggccccggcgaagacctctttgccaagatacagacgcaactggccacagcccag
attgcctgtattttcatcgacgaggcccagtttctaagcgatgcgcaagtgtggcaactg
gcacgtgcagtggatgatctgaaggttccaatcatgtgctacgggctgcgggtggatttt
cagggcaagctgtttcccggctcggccactctgttggcactggcggacgaaatgcgcgaa
gtgcgcaccatctgccattgcggcaagaaggcgtcgatggtcgtccggcaagacgcgcag
ggcaacgtggtcaaggacggcgcacaggtgcagatcggcggcaacgagacttacgtcagc
ctgtgtcgccgccactggcgcaaggcgacgggcgacattgcctag

DBGET integrated database retrieval system