KEGG   Sulfitobacter pseudonitzschiae: SULPSESMR1_03614Help
Entry
SULPSESMR1_03614  CDS       T04974                                 

Gene name
puuE
Definition
(GenBank) 4-aminobutyrate aminotransferase PuuE
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
spse  Sulfitobacter pseudonitzschiae
Pathway
spse00250  Alanine, aspartate and glutamate metabolism
spse00410  beta-Alanine metabolism
spse00640  Propanoate metabolism
spse00650  Butanoate metabolism
spse01100  Metabolic pathways
spse01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:spse00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SULPSESMR1_03614 (puuE)
   00650 Butanoate metabolism
    SULPSESMR1_03614 (puuE)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SULPSESMR1_03614 (puuE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SULPSESMR1_03614 (puuE)
Enzymes [BR:spse01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     SULPSESMR1_03614 (puuE)
Amino acid related enzymes [BR:spse01007]
 Aminotransferase (transaminase)
  Class III
   SULPSESMR1_03614 (puuE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ASM75657
UniProt: A0A221K9W8
LinkDB All DBs
Position
pSMR1-6:65795..67072
Genome map
AA seq 425 aa AA seqDB search
MLNSEISTRRDDAISRGVGMQTQVYVERASGAEVWDVEGKRYIDFAAGIAVVNTGHCHPK
VMEAVRRQTESFTHTCHQVLPYENYIRLAERLNDKVPGDFEKKTVFVTTGAEAVENAIKV
ARAATSRNAIIAFGGGFHGRTFMGMSLTGKVAPYKKGFGAMMPDVFHVPFPVDLHGVSTA
DALAGIEKLFKADLDADRVAAIILEPVQGEGGFYPAPADLMRGLRKLCDAHGILLIADEV
QTGFARTGTLFAMEAYDVAADITTMAKGLAGGLPLAALTGRAEVMDAAVPGGLGGTYGGN
PLGIAAAHAVLDVIEEEDLCNRANELGSRLKQRLNAIRSRVPEMVDVRGPGFMIAAEFNT
ADGKAPNPEITNAIRAEALSRGLVLLTCGVYGNVIRFLAPLTIPDDVFAEAMDILEASID
AVKGA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgcttaactctgaaatctccacccgccgcgatgacgccatctctcggggtgtcggcatg
cagacgcaggtctatgtcgaacgcgcctccggggccgaggtctgggacgtcgaaggcaag
cgttatatcgacttcgccgccgggatcgccgtggtcaacaccggccattgccatcccaag
gtgatggaggccgtgcgccgacagacggaatctttcacccacacctgccatcaggtccta
ccgtatgaaaattacatccggctggccgaacggctgaacgataaggtgcctggcgacttc
gagaagaagactgtcttcgttactaccggtgccgaagcggtcgagaacgcgatcaaggtc
gcgcgggccgccaccagccgcaacgctatcatcgcctttggtggcggcttccacggccgg
acttttatggggatgagcttgaccggcaaggtcgcgccttacaagaagggcttcggggcg
atgatgcccgacgtcttccacgtacctttcccggtggatctgcacggtgtgtccaccgcc
gacgcgctggcggggatcgaaaagctgttcaaggccgatctggacgccgaccgtgtggcc
gcgattattttggaacccgttcagggcgaaggcggcttctatcccgcccccgccgatctg
atgcgcgggctgcgaaaactgtgcgacgcgcatggcatcctgctgatcgcggatgaggtg
cagaccgggttcgcccggaccggcacgctctttgcgatggaagcctatgacgtcgccgcc
gatatcaccaccatggccaagggtctggccgggggcctgccgctggccgcgctgaccggc
cgggccgaggtgatggacgccgccgtacccggcggcctggggggaacctatggcggcaac
cccctggggatcgccgcggcccatgcggtgctggatgtcatcgaagaagaagacctctgc
aaccgcgccaacgaactgggatcacgcctgaaacagcggctgaatgcgatccggtcgcgc
gtgccggaaatggtcgacgtgcgcggccccggcttcatgatcgcggccgagttcaacacc
gccgacggcaaggccccgaaccccgagattaccaatgccatccgggccgaggcgctgtcc
cgcgggctcgttttgctgacctgcggtgtttatggcaacgtgatccgtttcctagcgccg
ttgactattcccgacgatgtctttgccgaggcaatggacatcctagaggcgtcgatcgac
gccgtaaaaggggcctga

DBGET integrated database retrieval system