KEGG   Shewanella psychrophila: Sps_00669Help
Entry
Sps_00669         CDS       T05063                                 

Definition
(GenBank) glycosyl hydrolase, glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00500  Starch and sucrose metabolism
spsw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sps_00669
Enzymes [BR:spsw01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Sps_00669
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucodextran_N Glyco_hydro_15 HTH_DeoR
Motif
Other DBs
NCBI-ProteinID: AQS35863
UniProt: A0A1S6HK30
LinkDB All DBs
Position
complement(716391..718892)
Genome map
AA seq 833 aa AA seqDB search
MFRGYLPLPVTKTLVILAIIAALSACSPTTDKPVMDILGANMFSPGAPGTEPTWAFAGKT
GIGTSYTPYLNPKNNAEAQSKVWFSIAQGVLTETMYGLIHNAQLKELQFIVTGNGFVDTE
KQDTVSTIDYLHKDELGRPLSLAYKVINTDKNGKYQIEKHIFTDPLHASLMMQVTFTAFE
EGITPYLYLNPHMDNSGANDIAHVVSQDGKLALVSYTNNLDSSVMTVKSDLAFIKASAGF
VGVSDGLSDIKHNGEMNWQYRSTSAPQEQTIGNVALTAQLPVLEKSTDKEIKSLSFNLVL
GFGNDPVQSMANADATLARGYNQVLADYNGEGEAIGWQDYLTSLTALPAMSGNTKDEGKL
LYASALVLKAQEDKTHSGALIASLSNPWGDTVSAKVGSTGYKAVWPRDFYQCAMAFLAMG
DTQTPKVAFEYLQKVQVTKRTPGYTGTPGWFLQKTHVDGEIEWVGVQLDQTAMPIMLGWK
LWQAGIFTDTEIAHWYQQILKPAAEFLVTGGEVNLDWNHTHITPLNTQQERWEEQQGYSP
STAAAVISGLVSASDIARIAGDLTGAKRYLDTAKAMKKGLTDLVITTVGLLSTDGVSMTR
TDEQITPPYYLRISPQGKPNEATTLGDNNGRAGLDQRLILDGGFLELVRYGVIPADDAVI
KQTLALMDNTQLDDNLRVKYTFTTKDGSQFPGFRRYGNDGYGEDTETGASYAENGANTPH
QRGRVWPFFTGERGHYELALSTENNALTDKRRSELVDTYVQGMESFANQGLMLPEQVWDS
VGNPSRYHYQHGQGTNSATPLAWTHAEYIKLVRSLTDKQVWDHYPVVDAKLNN
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgttccgtggatatttacctttacctgtaactaagacgctagtgattctggccatcatt
gcagcgctcagtgcctgctcgccaacaactgataaacccgtgatggatatactaggggca
aacatgttttccccaggtgctcctgggactgagcccacatgggcatttgccggtaagact
ggcataggcacctcttacacaccctacttaaaccctaaaaataacgctgaggcgcagagt
aaggtctggttctccatcgcacaaggcgtcctgaccgagaccatgtatggtctgatccat
aacgctcaacttaaagagttacagtttatcgtcactggaaatggtttcgtcgatacggag
aaacaagatacagtcagcacaatagactatcttcacaaagatgagttaggtcgcccgtta
tcactggcttacaaggtcatcaacacagataagaatggcaagtatcaaatagagaaacat
atctttaccgacccgctccacgccagcctgatgatgcaggtgacctttaccgccttcgag
gaggggatcaccccttacctttacctgaatccccacatggataatagcggcgccaacgac
atagcccatgtggtgagccaagacggaaaactggcactggtgtcttacaccaataaccta
gattccagtgtgatgacggtgaaatccgatctggccttcatcaaagccagcgctggtttc
gttggggtttccgatggccttagcgacattaaacacaatggcgagatgaactggcagtac
agatctacatcagctccacaagagcaaaccataggtaatgtggccctcaccgcgcaatta
cctgtactcgaaaagagcacagataaagagattaagagtctcagcttcaacctggtactg
ggatttggtaatgaccctgtccagagcatggccaacgccgatgcgactttggcacgaggc
tataatcaagtattggccgactataatggcgagggcgaagcgataggttggcaagactac
cttacctcgttaaccgctctgcctgctatgtccggcaataccaaagatgagggcaaactc
ttgtatgccagcgctttggtactcaaggctcaggaggataagacacatagcggcgccctt
atcgcctccctctctaacccttggggtgacacggtatcggcaaaagtgggcagcacaggc
tacaaggccgtgtggccgcgagatttttatcaatgcgccatggcctttctcgccatggga
gacactcaaacacctaaggtagcatttgaatacttacagaaggtgcaagtcacaaagcgc
acccctggttacacagggactcccggctggttcttacagaagacccatgtggacggtgaa
atagagtgggttggtgtgcaactagatcaaactgccatgcccatcatgctcggctggaag
ctttggcaggctggcatatttaccgatacagaaatcgcccattggtatcagcagatactc
aaacccgcagccgaatttctcgtcactggtggtgaggtaaatcttgactggaatcacact
cacattacgccacttaacacccagcaagaacgctgggaggagcagcaaggctactcacca
tcaaccgcagccgcggtgatctcaggtttggtgtccgccagtgatatcgcacggattgca
ggagatctcactggtgccaagcgatacctcgacaccgcaaaagccatgaaaaaagggctc
acagatctggtcattaccactgtaggcttgcttagcaccgatggagtttccatgactcgc
actgatgagcagataactcctccttattatctgcgtatctcgcctcagggtaagcccaat
gaagcaacaacactcggcgataacaatggcagagccggcttagatcaacgtctcatatta
gacggtggctttctcgaattggtacgatacggtgtcatacctgcagatgatgctgtgatt
aagcaaactctggcactgatggataacactcaattggatgataatcttagggtcaaatac
acattcaccaccaaagacggcagtcagtttcccggattccgccgctatggtaacgatggt
tacggtgaagataccgagactggcgcgagttatgccgagaacggcgctaacacgcctcac
caaagaggtcgggtgtggcccttcttcaccggtgagcgtggccattatgaactggcacta
tccaccgaaaataatgcattaaccgataagcgccgaagtgagctggtcgatacttatgtt
caaggcatggaaagctttgccaaccaaggcctcatgctgccggagcaagtgtgggacagc
gtaggcaatcctagtcgatatcactatcaacatggccaagggactaactcggccactcct
ctcgcctggacccatgcagaatatataaaactggtacgatccctaacagataaacaagtc
tgggatcactatcctgtagtagatgctaagttaaacaactag

DBGET integrated database retrieval system