KEGG   Shewanella psychrophila: Sps_01127Help
Entry
Sps_01127         CDS       T05063                                 

Definition
(GenBank) oligoendopeptidase F
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
spsw  Shewanella psychrophila
Brite
Enzymes [BR:spsw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     Sps_01127
Peptidases [BR:spsw01002]
 Metallo Peptidases
  Family M2
   Sps_01127
Exosome [BR:spsw04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sps_01127
CD molecules [BR:spsw04090]
 Proteins
  Sps_01127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2 TarH
Motif
Other DBs
NCBI-ProteinID: AQS36309
UniProt: A0A1S6HLC8
LinkDB All DBs
Position
1247988..1249826
Genome map
AA seq 612 aa AA seqDB search
MSLFKPKLSRLSLLIALSIGLSACNASNNDENDSVLSKTEEAEQFLTQSEQTLSELSVEI
NRAEWIYSNFITDDTAALSASASEKLTATSVRLATQAAQYTDLKLDDASQRKLNILRSSL
VLPAPLDPDKNAELAGISSQLNGLYGKGKYCFDDGHCLTQPELSAIMAESSDPKLLLEVW
QGWREIAKPMRPLFQREVELANEGANDLGYADLSVLWRSQYDMKPDEFSNELDRLWGQVK
PLYDSLHCYVRGELNEEYGDEIVPSNGPIPAHLLGNMWAQSWGNIYDKVSPQDADPGYEV
TQLLAEHDYDEVKMVKQAENFFSSLGFDELPDSFWTRSLFVQPKDRDVVCHASAWDLDNL
DDIRIKMCIQKTAEDFTVIHHELGHNYYQRAYKEQPFIFKNSANDGFHEAIGDTIALSIT
PSYLKQIGLLDEIPDASKDIGLLLKQALDKVAFMPFGLMIDQWRWKVFSGEITPAKYNQA
WWDLREKYQGVKAPIERSEDDFDPGAKYHVPGNVPYTRYFLAHILQFQFHKSLCETAGDT
GPVHRCSIYGNKAAGSKLNTMLEMGLSRPWPEALNVVTGSQEMDASAVLDYFAPLQVWLN
EQNAQANRQCGW
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtcacttttcaagccgaagctttcacgtctttcgctacttatcgcgctttcaatagga
ctatctgcctgtaatgcctcgaataatgacgaaaacgactcagtattatctaaaacagaa
gaggctgaacaattcctaactcagtctgagcagacattgagtgagctgtcagtcgaaata
aatcgtgccgaatggatctacagcaactttattaccgacgatacagcggccctgtcagca
tcagcaagtgagaaacttaccgcaacatcggtcagactcgccacccaagctgcacaatat
actgatttaaaactagatgatgccagtcaacgcaaactcaatatcttacgtagttctttg
gtactccccgccccactcgatccggataaaaatgctgaacttgcagggataagttcacag
ctcaatggcttatatggtaagggaaaatattgcttcgatgacggccactgcttaactcaa
cctgagttgtccgcaatcatggcagaatccagcgaccccaaattattgctagaagtatgg
caaggttggcgtgagatagccaaacctatgcgtcctctgttccagcgcgaagttgaattg
gccaatgaaggcgcaaatgaccttggctacgccgatttgtcagtattgtggcgcagtcaa
tatgacatgaagcctgatgagttctcaaatgaattagacagactatggggtcaagttaag
cccctctatgattcattacactgttatgttcgtggcgagctcaatgaagagtatggcgat
gaaattgtaccgtcaaatggaccaattccggctcacttacttggaaacatgtgggcgcaa
agttggggcaatatctatgataaagtctcgccacaagatgcagatcctggctatgaagtc
actcaattacttgccgagcatgactatgatgaagtcaaaatggttaagcaggctgaaaac
ttctttagctcactcggtttcgatgagctaccagactctttctggactcgttcgttattc
gtgcaacctaaagatcgtgatgttgtgtgtcatgcatcggcttgggatctggataacctc
gatgatatacggatcaagatgtgcattcagaaaacggcagaagattttaccgttatccat
catgagctaggccacaactattaccagcgagcatacaaagagcagcctttcatctttaaa
aatagtgcaaatgatggcttccacgaagcgattggtgacaccattgccttatctatcacc
ccgagttatctcaaacagataggcttactcgatgaaatccccgatgcctcgaaagatatc
ggcctgttactcaagcaagccttggataaagtcgcctttatgccctttggcttgatgata
gatcaatggcgctggaaagtgttcagtggtgaaatcacaccggctaaatataaccaagcc
tggtgggatctcagagagaaataccagggagtcaaggcacccatcgagagaagtgaagat
gacttcgacccaggcgctaaataccatgtacccggtaatgtcccttatacgcgttatttc
ctggctcacattttacagttccaattccacaaatccctgtgtgagactgctggtgatacg
gggcccgtacatagatgtagcatctatggcaataaagctgcaggcagtaaactcaatact
atgttggagatggggctaagccgtccatggcccgaagcgctgaacgttgtaaccggtagt
caggagatggatgccagtgccgtactcgattactttgccccgttacaagtttggttaaat
gagcagaacgctcaggctaatcgccaatgtggttggtga

DBGET integrated database retrieval system