KEGG   Shewanella psychrophila: Sps_01984Help
Entry
Sps_01984         CDS       T05063                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein, PhoT family
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
spsw  Shewanella psychrophila
Pathway
spsw02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Sps_01984
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spsw02000]
    Sps_01984
Enzymes [BR:spsw01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     Sps_01984
Transporters [BR:spsw02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    Sps_01984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_23 AAA_29 ABC_ATPase AAA_16 AAA_15 AAA_30 AAA_33 Rad17 NB-ARC AAA AAA_25 AAA_18
Motif
Other DBs
NCBI-ProteinID: AQS37144
UniProt: A0A1S6HNR2
LinkDB All DBs
Position
complement(2233577..2234395)
Genome map
AA seq 272 aa AA seqDB search
MISIDKSAMSTKFVDLKNLSQEDTALEIRNLDLKYGDKQALFDVSMKIPEKQVTAFIGPS
GCGKSTLLRCINRMNDLVDNCHISGEVLLHGQNIYDKKVDVAALRRNVGMVFQRPNPFPK
SIYENVVYGLRLQGINNRRDLDDAAERSLRGAAIWDEVKDRLHDNAFGLSGGQQQRLVIA
RAIAIEPEVLLLDEPTSALDPISTLTIEELITELKSKYTVVIVTHNMQQAARVSDQTAFM
YMGELVEYADTNTIFTTPQKRKTEDYITGRYG
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgatttcgatagataagtcagcgatgagtacaaaatttgtggatctgaaaaacttgagc
caggaagacacagccctggagatccgtaacttagatttgaaatatggcgataaacaggcc
ctgtttgatgtatcgatgaagataccggaaaaacaagttacggctttcatcggtcccagt
ggttgtggtaagtcgactctgctgcgctgtattaaccgcatgaatgatctggtggataat
tgccatattagtggtgaagtcttgctacacggacaaaatatttatgacaagaaggtcgat
gttgcggccctacgtcgtaacgttggtatggtattccagcgtcctaacccttttcctaaa
tccatctatgaaaatgtggtctatggattgcgcctccaaggaataaacaatcgtcgtgat
cttgatgacgccgcagagcgctctcttcgtggtgcagcgatatgggatgaagtgaaagac
aggcttcatgataatgccttcggcctttcgggtggtcagcaacagcgtctggtgatagct
cgtgccatcgccattgagcctgaggtgctactactggatgaacctacatcggctctggat
cctatctcaactctgacgattgaagagctgatcactgagcttaagtctaagtataccgtg
gtgatagtgactcataacatgcaacaagcggctcgtgtatcagatcaaactgcatttatg
tacatgggtgagttggttgagtatgccgataccaataccatttttaccacgccacagaaa
cgtaagacggaagattacattaccggtcgctacgggtaa

DBGET integrated database retrieval system