KEGG   Shewanella psychrophila: Sps_04375Help
Entry
Sps_04375         CDS       T05063                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00550  Peptidoglycan biosynthesis
spsw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sps_04375
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sps_04375
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spsw01011]
    Sps_04375
Enzymes [BR:spsw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sps_04375
Peptidoglycan biosynthesis and degradation proteins [BR:spsw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Sps_04375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer Afaf Talin_middle
Motif
Other DBs
NCBI-ProteinID: AQS39467
UniProt: A0A1S6HV82
LinkDB All DBs
Position
4964280..4966136
Genome map
AA seq 618 aa AA seqDB search
MAPRKRITMHDHAAEASLFKRRALFTFVCVVILLSILVANLYHLQILSYKDYATRSNDNR
IRVVPVAPSRGLIYDRHGKLLAENQPFYSLELIPEKIKDVPEVLRELSLVIPISADEQED
FLVSLKHHRRFKPLTLKNRLTEEQVALFSVNQHKFPGISVVAGLKRHYPYNSLMTHALGY
VGRINDRDQAALRRSEQWKNYAATKDIGKLGIEKFYESLLHGKPGHLEEEVNNRGRTIRT
LKSVAPQPGQDIYLTLDLKLQQKAMELLDGRRGSVVAIDPRDGGILALLSSPSYDPNLFV
HGISSKAYNKLLSSKSKPLINRATQGQYAPASTVKPHLALLGLEAKTVTPKTRIWDPGFW
QIPGVDRKYRDWKRWGHGWVDVTSALIHSCDTYFYDLAYKTGVDKIAEFMGPFGFGERTG
VDIFEESAGIMPSKEWKRLRYNQPWYIGDTISVGIGQGYWTTTPLQLANAAAIMANKGRR
FTPHLLKSIKDNTSKIDTPIDELAPIVLKNPENWDIVNKAMQDTAQKKRFKNAGYTAAMK
TGTAQVISVAEDAKYDADAIAEHFRDNALVIAYAPYENPTIVLAVVLENAGWGGANAGPV
AKALLDEYMLRDTLEPLQ
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtggcgccaagaaagcgaattacgatgcatgaccacgcagctgaagcatcgctttttaaa
cgaagagccttgtttacttttgtttgtgtagtcatcttattaagcatactggtggcaaac
ttatatcacctacaaatcctctcatataaagattacgcaactcgctcgaacgataaccgt
atcagggtagtcccagtagccccgagtcgtggtttgatttatgaccgtcatggcaagcta
ttagcagaaaaccaaccattttactctttagagctcatccctgaaaaaataaaagatgtc
cctgaggtactcagagaattaagcctagttatccctatctcagccgatgagcaggaagat
ttccttgtgtctttgaagcaccacagacgctttaagccgctcacgttaaagaaccgttta
accgaagaacaagtcgcactttttagtgttaaccaacataaattcccgggtatttctgtg
gttgctggtctcaagcgacattacccatataattccttgatgacccatgcactaggctat
gttggccgcatcaacgatcgtgatcaagcggcattgcgccgaagtgaacaatggaaaaac
tacgccgcaaccaaagatataggtaagctaggcatagagaaattctatgagagcctactt
catggtaaaccaggtcatttagaggaagaagtcaataaccgtgggcgtaccatacgcacg
cttaaatctgtggctccacaaccaggccaggacatctacctcacattagatttaaagtta
cagcaaaaagccatggagctactcgatggtcgcaggggctctgtggtggccatagacccg
cgagatggcggtatactggctttgttatctagccccagctacgatccaaacttgttcgtt
cacgggatcagcagtaaggcctacaacaaactgcttagctcaaaatccaaacctctgatt
aaccgagcaacccaagggcaatacgcacctgcatcgacagttaaacctcacttagcctta
ttggggctagaggccaaaactgtcacacctaagactcgcatctgggatccgggtttttgg
cagatccctggtgtagatagaaaatatcgtgactggaagcgatggggccatggctgggtt
gatgttaccagcgctttgattcactcctgcgatacctacttctatgatctggcctataaa
acaggtgtagataagatagccgaatttatgggtcccttcggcttcggcgagcgcactggg
gtagatatcttcgaggagtcggcaggtatcatgccgtctaaagagtggaagcgtcttcgc
tacaaccagccttggtatattggcgacaccatttcggtgggcataggacaaggttactgg
actacgaccccacttcaactcgccaatgcagctgcaattatggccaataagggacgccga
ttcacaccacacttgcttaaatcgattaaagacaacacttctaaaatcgatactccaatc
gacgagttagcaccaattgtgctaaaaaaccctgagaactgggatatcgtcaataaggca
atgcaagacacagcgcaaaagaagcgctttaaaaatgctggttacaccgcagccatgaaa
actggtacggctcaggtcattagtgttgccgaagatgccaaatatgatgcagatgctata
gcagagcattttcgggataacgcactcgttatagcctacgctccttatgaaaatcccact
atagtcctcgccgtggtattagaaaatgccggttggggtggcgccaatgcaggcccagta
gcaaaagccttgctcgatgaatatatgttaagagataccttggagccccttcaatga

DBGET integrated database retrieval system