KEGG   Shewanella psychrophila: Sps_04379Help
Entry
Sps_04379         CDS       T05063                                 

Definition
(GenBank) penicillin-binding protein 6
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00550  Peptidoglycan biosynthesis
spsw01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sps_04379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:spsw01002]
    Sps_04379
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spsw01011]
    Sps_04379
Enzymes [BR:spsw01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sps_04379
Peptidases and inhibitors [BR:spsw01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   Sps_04379
Peptidoglycan biosynthesis and degradation proteins [BR:spsw01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Sps_04379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: AQS39471
UniProt: A0A1S6HVC9
LinkDB All DBs
Position
4969480..4970652
Genome map
AA seq 390 aa AA seqDB search
MKFLNSPLKTLILATSFACSYTYAAPVVTPNAPTVAAKAYVLMDYNTGQIIAEENAYESL
NPASLTKMMTSYVIGHEIKVGNISPEDEVTISKKAWSKNFPDSSKMFIEVGKKVTVDDLN
HGIIIQSGNDACVAMAEYIAGTEDGFVDLMNSWATQLGMKDSYFENSHGLDAENHKSTAY
DMALLGAALIRDVPDEYAVYKQKSFTYNGIKQYNRNGLLWDKSMSVDGIKTGHTSGAGYN
LVTSATKDGMRLVSVVMGTRSESARKAESKKLLNYGFRFFETITPYKAGDSFVSQQIWFG
DKESVDLGVITDTPITISRGQAKNLQANFELTKELTAPLAKGETVGRIYFQLNGKDIAQF
PLVTLQEINEGSWFSKLMDYFKQMFAGWFS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttttaaatagccctttaaaaacgcttattcttgcgacctcgttcgcgtgctca
tacacctatgcagcaccagtagttactcctaatgcaccaactgttgcggcgaaagcctat
gtcttaatggactacaatacaggacaaatcattgcggaagaaaatgcttacgagagctta
aacccagcaagtctgactaagatgatgaccagttatgttattggccatgaaatcaaggtc
ggtaatatctcacctgaagacgaagtcaccatcagcaaaaaggcttggtcaaagaacttt
cctgactcttcgaagatgttcattgaagttggtaagaaagtcacggtcgatgacttaaat
cacggtatcatcattcagtccggtaacgatgcttgtgttgctatggctgagtacattgcc
ggcacagaggatggctttgtcgatctgatgaattcctgggcaacacagctgggaatgaaa
gatagttattttgagaattcacatggcctagacgctgaaaaccataagtcgacggcctat
gatatggcactcttaggcgcagcgcttatccgtgatgtgccagatgaatatgctgtctac
aaacaaaagtcatttacctataacggtattaagcagtataaccgtaacggtctcctatgg
gacaagagcatgagtgtcgacggtataaaaacaggacacacgtcaggcgctgggtataac
ttagttacatcagcaacaaaagatggcatgcgtttagtttcagtcgttatgggcaccaga
agtgaaagtgcacgtaaggccgaaagtaaaaagctgctcaactatggtttccgtttcttc
gaaacaattactccatacaaggcgggtgatagctttgtctcacagcagatttggtttggc
gacaaagagtccgttgatctaggcgttataaccgacacacctatcactatcagccgtggc
caagctaaaaacttgcaggccaacttcgagttaaccaaagagctaacggcgcctttagca
aagggcgagactgtgggtcgtatctacttccaacttaatggcaaagatatcgctcaattc
ccactggtcaccctgcaagaaatcaacgaaggtagctggttcagcaaacttatggattac
tttaagcagatgtttgcaggctggtttagctag

DBGET integrated database retrieval system