KEGG   Shewanella psychrophila: Sps_04929Help
Entry
Sps_04929         CDS       T05063                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spsw  Shewanella psychrophila
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Sps_04929
Enzymes [BR:spsw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Sps_04929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored HI0933_like Thi4 NAD_binding_7 DAO FMO-like NAD_binding_8 AlaDh_PNT_C FAD_binding_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AQS40009
UniProt: A0A1S6HWW9
LinkDB All DBs
Position
complement(5555979..5557556)
Genome map
AA seq 525 aa AA seqDB search
MLDTNLKNQLKTYLQNLKRPVELAVSADDSPKALELKSLAQDIDSLSELVTVSEVQGERM
PSMKVTSVDTGTSITFAGLPMGHEFTSLVLALLHTGGHPLKLDDNVIAQIKALPGEYHFE
TYVSLSCQNCPDVVQALNMMAAVNPNITNVMIDGALFQTEVFERDILAVPSVYLNGEPFA
QGRISLVEILNKIDTGAVTRQAEQLAQKDVFDMLVVGGGPAGAAAAIYSARKGLSTGVVA
DKFGGQVAETVAIENFISVKATEGPKLVANLESHVREYDVDVMDNQRGTKLTPSQGLNPY
HELTLENGAILKSQTLLLATGARWREMNVPGEQAYRGKGVAYCPHCDGPLFKGKRVAVIG
GGNSGIEAAIDLANIVEHVTVLEFDIKLRADDVLQRKAASMDNITIITQAMTTEVLGDGS
RVNGLNYTDRATDEQHSIELAGIFVQIGLIPNTEWLKGVIDLTPRGEIVVDERGQTSIPG
IFAAGDVTNTPYKQIIIAMGSGATASLGAFDYLIRHSVPEQANAA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttggatacgaatcttaaaaatcaactgaaaacctatctgcaaaacctcaagcgtcca
gttgaacttgccgtgtctgcagatgatagccctaaggcactggaacttaagtcactggcg
caagatattgatagtttgtctgaattagtcactgtgtcagaagttcaaggtgagcgtatg
ccatcaatgaaggtgacaagtgtcgacacaggcacaagcattactttcgctggcttgcct
atgggtcatgaatttacctcactagtattggcattactgcatactggcggacacccactg
aagttagatgataatgttatcgctcagatcaaagcgctaccaggtgaatatcatttcgag
acctatgtttctttaagctgtcaaaattgtcccgatgtcgttcaggcattgaatatgatg
gctgcagtcaatccgaatattaccaatgtgatgatagacggtgcgctttttcagactgaa
gtgtttgagcgtgacatcttagcggtaccttctgtttatctaaatggcgaacctttcgca
cagggaaggatcagtttagttgaaatcctcaataaaattgataccggggctgtgactcgt
caggctgaacaattagcacagaaagatgttttcgatatgctagtagttggcggcggacct
gctggtgcggccgcagcaatctactcggcacgtaaaggtttaagcactggtgttgttgcc
gataagtttggtggtcaagtggctgaaactgtggctatcgaaaactttatttcagtcaag
gcgaccgaagggcctaagctggttgcaaaccttgagtcccatgtacgtgaatatgatgtt
gacgtgatggacaatcaacgtggaactaagttgactccaagccaagggctaaatccttat
catgaactaacgcttgaaaatggtgcgatactaaaaagccaaactttgctactcgccact
ggcgcgagatggcgtgaaatgaatgtcccaggcgagcaagcgtatcgtggtaaaggtgtg
gcttactgtccacactgtgatggtcccttgttcaaaggaaagcgagttgctgtcataggt
ggtggtaattcgggtatcgaagcggcaattgatttagctaatattgttgagcatgttact
gtactggaatttgatattaagcttagagctgatgatgtgctgcagagaaaggcagcatct
atggacaatatcaccatcattactcaagccatgacaactgaggttcttggtgatgggtca
cgagtcaacggacttaactacacagatagagccacggatgagcagcacagtatagagctg
gctggtatctttgttcagataggtttaattcctaacaccgaatggcttaaaggtgtgata
gatctaacaccgagaggggaaatagttgtagatgagcgtggacagacatctatacctggc
atatttgctgctggggatgtgactaatactccttataagcagatcatcatcgccatgggc
agtggcgctacagcatcactaggggccttcgattacttgattcgacatagtgtacccgaa
caagcgaatgccgcttaa

DBGET integrated database retrieval system