KEGG   Shewanella psychrophila: Sps_04946Help
Entry
Sps_04946         CDS       T05063                                 

Definition
(GenBank) two component transcriptional regulator, winged helix family
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
spsw  Shewanella psychrophila
Pathway
spsw02020  Two-component system
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Sps_04946
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:spsw02022]
    Sps_04946
Two-component system [BR:spsw02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   Sps_04946
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AQS40025
UniProt: A0A1S6HWU0
LinkDB All DBs
Position
5575729..5576448
Genome map
AA seq 239 aa AA seqDB search
MQNPHILIVEDEAVTRNTLRSIFEAEGYVVTEANDGAEMHKAMQENKINLVVMDINLPGK
NGLLLARELREINNIGLIFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLTR
VNSTGAEAEDKNSVEFYRFNGWSLEINSRSLVSPQGESYKLPRSEFRAMLHFVENPGKIL
SRADLLMKMTGRELKPHDRTVDVTIRRIRKHFESLPDTPEIIATIHGEGYRFCGNLEEA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaacccgcacattctgattgttgaagatgaagccgttacccgtaacacgctaaga
agtatttttgaagctgaaggatatgtggtaactgaagccaatgatggcgcagaaatgcat
aaagccatgcaggaaaataagatcaacttggttgttatggatatcaaccttcctggcaaa
aacggtcttctgttagcacgtgaacttcgtgaaataaacaatatcggtctaatcttccta
acgggccgagataacgaagttgacaaaattttgggtcttgaaattggtgcagatgattat
atcactaaaccattcaacccacgtgaactgactattcgtgctcgcaacctattgactcgc
gtcaatagcactggtgcagaagccgaagataagaacagtgttgagttctaccgtttcaac
ggttggagccttgaaatcaacagccgttctttggttagcccacaaggtgaatcgtacaag
ctgccacgtagtgaattccgcgctatgctgcattttgttgaaaacccaggcaagatcctt
agccgtgctgaccttctaatgaagatgacaggccgcgagcttaagccacatgaccgtaca
gttgacgtaacgattcgtcgtatccgtaagcacttcgaaagcttgcctgatacgccagaa
atcatcgccactattcacggtgaaggttatcgtttctgcggtaacttagaagaggcataa

DBGET integrated database retrieval system