KEGG   Shewanella psychrophila: Sps_05417Help
Entry
Sps_05417         CDS       T05063                                 

Definition
(GenBank) penicillin-binding protein, 1A family
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00550  Peptidoglycan biosynthesis
spsw01100  Metabolic pathways
spsw01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Sps_05417
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Sps_05417
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:spsw01003]
    Sps_05417
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:spsw01011]
    Sps_05417
Enzymes [BR:spsw01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     Sps_05417
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Sps_05417
Glycosyltransferases [BR:spsw01003]
 Polysaccharide
  Bacterial polysaccharide
   Sps_05417
Peptidoglycan biosynthesis and degradation proteins [BR:spsw01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   Sps_05417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase Sacchrp_dh_C
Motif
Other DBs
NCBI-ProteinID: AQS40485
UniProt: A0A1S6HY60
LinkDB All DBs
Position
6090400..6092931
Genome map
AA seq 843 aa AA seqDB search
MKWFKRIVIALFSLTLLGIGAIAGAYFYVLPDLPDVNTLKTVKLQTPLRIYSSDGKLISQ
FGEKRRIPVAFEDVPSLLIDAVLDTEDARFFEHHGIDPIGITRAAIILITTGKKSQGAST
ITQQVARGFFLSREKTYIRKVKEIFLAIKIEKALSKEQILELYLNRSFLGNRAYGVGAAA
QVYYGKELEELNLPEMAMIAGLPQAPSAANPIRNPSRAVDRRNWVLSRMLEKQNITQAQY
SDAIQAPVSAKYHGAEISLYAPYISEMARDYLVDKLGEEEAYTGGYNVYTSIDSKLQLDA
QHALRNNVYSYDQRHGYRGATDVLWTDTPLETSHILTRLKQTQAFQGLMPAAVMSIEDQS
ASLLISSGDTIQVDWQGLKWARKFISNKRQGKAPKTAGQVLKVGEQVWLRNNGDFWQLSQ
IPVVSSAIVSLDPHNGAIQALVGGFSFHTSQYNRVTQAKRQLGSNIKPFIYTAAIQKGYT
LSTLINNAPINNADTRQGTAWRPKNSPDRYTGPTRLRVGLAQSINVMSVRTMRYAGLDKA
IDTLVKFGFTREDIPRNESIALGSNSVTPLQVVTAFSTFANGGYKVEPYFIERIEDSYDN
VIEESNPTLACTPNTETLAPISDDPFAAMAEEFKQAEQVTDNAICGGPDARYAEHIISEQ
TAFLVTEALKSVIWGGGNWSKGTGWNGTAWRASRVVKRHDIAGKTGTTNESRDTWFSGFN
PKLATTVWVGFDDHSKELGRTSWDANGAKDQISAAEAGAKTAGPGWNEFMKDALAGTPEV
PTTPPKGIISVRIDLATGKLTRKTDYTSKFEYFVSGTEPKEFATETNESNDIFLEDSTEE
LFQ
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtggtttaaacgtattgttatcgctctttttagtttaaccctattaggaataggc
gctattgctggagcatatttctatgtgttgcccgatcttcctgacgtaaatacactgaag
acagtaaagctacagacgcctttacgcatctacagcagtgacggaaaactgatctcacaa
tttggcgagaaaagacgtatccctgtagcctttgaggatgttccgtcattacttatcgat
gctgttttagacactgaagatgcccgctttttcgaacatcacggcatagatcctattggt
atcactcgagcagctatcattctgataaccacagggaagaaaagccaaggagccagtact
atcacacaacaggtggcacgcggattcttcctctctcgtgaaaagacctatatacgaaaa
gttaaagaaatatttctagcgattaaaatagaaaaagcactatcgaaagagcaaatttta
gagctttacttgaaccgttcttttttaggaaaccgtgcatatggtgtaggggcagctgca
caagtttattatggtaaagagctggaagaacttaacttaccagaaatggccatgatagcc
ggtctccctcaggcaccatcagcagcgaatccaatccgaaacccaagtcgagcagtcgat
cgacgcaattgggtattgagccgtatgttagagaaacagaatattactcaagcgcaatat
tctgatgctattcaagcccccgtatcggcaaaatatcatggtgcagaaatcagcttatat
gccccctatatttccgaaatggctagagattatctggtagataaattgggtgaagaagag
gcatataccggtggctataatgtctacaccagcatagactccaagcttcagttagacgct
cagcatgcactgaggaataacgtgtattcctacgatcaaagacacggctaccgtggtgct
accgatgttttatggactgataccccactcgagacttcccatatactcacacgactaaaa
caaactcaggctttccaaggcctgatgcccgccgcggtcatgagtatcgaagaccagagt
gcatccttgcttatctcttcaggtgataccattcaagtggattggcaaggtttgaaatgg
gctcgaaaattcatcagcaataaacgacaaggaaaagcgcctaaaacggcagggcaagtg
ctaaaagttggcgaacaggtctggttacgcaataacggtgacttctggcagttatcccag
atacccgttgtatccagtgccatagtatctctcgacccacataatggtgcgatacaagca
ttagttggtggcttcagttttcacacaagtcaatataaccgtgtcacccaggcaaagcgt
cagttaggctcgaatattaaacccttcatttacacggctgcaattcagaaaggttatacc
ctctcgacactcattaacaatgcacctatcaataatgcagataccagacaaggcaccgca
tggcgtcctaagaactcaccagatcgttacacaggaccgactagattacgtgtagggcta
gctcaatccatcaacgtcatgtcagtgagaaccatgcgttatgctggcctcgacaaggct
attgataccttagtcaaatttggttttacgcgtgaagatatccctagaaacgagtctatt
gcactgggttcgaactctgtcacacctctacaggtcgtcacggctttctccactttcgct
aatggtggctataaggtcgaaccttactttatagaacgaattgaagactcctacgacaac
gtgattgaagaatcaaatccaactttagcctgcacacctaatacagagactctagcgcct
attagtgatgatccctttgccgctatggctgaagagtttaagcaggcagagcaggttaca
gataatgcaatttgtggtggtcctgatgctcgttacgccgagcatataatctctgaacaa
accgcattcttggttacggaagctttgaagagtgtaatttggggcggcggaaactggagc
aagggaaccggttggaacggtacagcttggcgagcgtcacgtgtggttaaacgacatgat
attgctggtaaaacaggtacaaccaatgaatcaagggatacttggttcagtggcttcaat
cctaaactggccaccactgtatgggtggggttcgacgatcacagtaaggagctaggtaga
accagctgggatgccaatggtgcaaaagatcagatctcagccgctgaagctggagctaaa
acggcagggccaggttggaatgagtttatgaaggatgcactcgccgggacgcccgaagtc
ccaacgacgcctcctaaaggcattatatccgtcagaatagaccttgccacgggaaaatta
accagaaaaaccgattacactagtaagttcgagtattttgtttctggaacggagccaaaa
gaatttgccactgagaccaatgaatcaaacgatatattcctcgaggattctaccgaagag
ctattccaataa

DBGET integrated database retrieval system