KEGG   Shewanella psychrophila: Sps_05424Help
Entry
Sps_05424         CDS       T05063                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase, type 1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
spsw  Shewanella psychrophila
Pathway
spsw00620  Pyruvate metabolism
spsw00680  Methane metabolism
spsw01100  Metabolic pathways
spsw01120  Microbial metabolism in diverse environments
spsw01200  Carbon metabolism
Module
spsw_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:spsw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sps_05424
  09102 Energy metabolism
   00680 Methane metabolism
    Sps_05424
Enzymes [BR:spsw01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Sps_05424
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 EcoR124_C
Motif
Other DBs
NCBI-ProteinID: AQS40492
UniProt: A0A1S6HYE9
LinkDB All DBs
Position
6100190..6102823
Genome map
AA seq 877 aa AA seqDB search
MTDMYASLRSNVGTLGQILGETIRTNLDDAFLDKIEQIRQLAKSSRQGDEAARDEMLKLL
TALPDDELVPFAKAFNQFLNLANIAEQFHTISRNCDELVCVPDPVEQLLGRVLSSNIDQE
KMLDCLQNLDIDLVLTAHPTEISRRTLIQKYSSVIDSLAALENPRLTEREKKQQHLRLRQ
LIAQIWHTNEIRHERPTPVDEARWGLSTIEVSLWQAIPDFLRQLNEQVEERTGKQLPIDI
APVRFSSWMGGDRDGNPFVTAVVTQEVLDRNRHTAARLYLKDIVLLVNDLSMEEANNELS
ALTNNSHEPYRDVLRELRVKLRNTIDYLNERLEGHNPEVEHSSIIWHENDLKEPLMMLYK
SLSDTGMSLIANGLLLDMLRRIACFGIHMLRLDIRQDAERHSDVIAELTRYLGMGDFDHW
DENEKQAFLLRELTSKRPLIPTNWQPSANVAEVISTCRLIATQPAKALGSYVISMASKPS
DVLTVLLLLKETGCPHPMRVVPLFETLDDLNNAATCMSALFAIDWYRGYTKGHQEIMIGY
SDSAKDAGVMAAAWAQYHAQEQLVEISRQADVKLTLFHGRGGTIGRGGGPAHEAILSQPP
GSVDGRIRVTEQGEMIRFKFGLPKLAVQSLALYTSAVMEATLLPPPEPKPEWRACIQRLA
EESVKAYRSIVREEPDFVAYFRAATPEVELGKLPLGSRPAKRKVDGGIESLRAIPWIFAW
SQNRLMLPAWLGAGEALQASIDRGDMSLLQEMEQEWPFFKTRISMLEMVYAKAEPNLAKY
YETCLVPENLHHLGEALRERLATGVKAVLELTQSDTLMSHTPWNKESITLRNPYIDPLNF
MQAELLARTRKEDASANVELALMLTIAGVAAGMRNTG
NT seq 2634 nt NT seq  +upstreamnt  +downstreamnt
atgactgatatgtatgcgtctttaaggtctaacgtgggtaccttaggacagattttaggt
gagaccattcgcaccaatttagatgacgcttttctcgataaaatagagcagatccgtcaa
ttagctaaaagctccagacaaggagatgaagccgctcgagatgagatgctcaagctgcta
accgcactcccagacgatgaattagttccctttgcgaaggcattcaaccaattccttaat
ttggccaatatcgccgagcaattccataccatcagccgtaattgtgatgaactagtatgc
gtacccgatccggtagagcagttacttggtagagtattgagcagcaatatcgatcaagag
aagatgctagattgcctgcaaaatctcgatattgatctggtattgaccgctcatcctaca
gagatatcacgtcgaaccctgatccagaaatattcatcggttatcgatagtctcgcggcc
cttgaaaacccacgacttaccgaacgagagaagaagcaacagcatctgcgtctcaggcag
ctcatcgcccaaatctggcataccaatgagatacgccacgagcgaccaaccccggtagat
gaggccagatggggacttagcaccatagaagtctctctctggcaagctattccggacttt
ctcaggcagctcaatgagcaagtagaagagcgtaccggcaagcaactacccatagacatt
gcaccggtacgattctccagttggatgggtggagatcgtgatggtaacccgtttgtcaca
gcagtcgtcacacaggaagtattagacagaaaccgtcacactgcggcacgtttatatctc
aaagatatcgttttattggtcaatgacctctcaatggaagaggctaacaatgaactatcc
gcgttaactaacaatagtcacgagccctatagagatgtgctacgtgagctcagagttaaa
ctgcgtaataccatagactacctcaatgagcgcctcgaaggacataatcctgaagtggag
cacagctccatcatctggcatgagaatgatctcaaagagcctctgatgatgctatacaag
agtctgtccgatacgggcatgagccttattgcaaatggccttctattagatatgctacgt
cgtatcgcctgttttggtatacatatgctcagactcgatatccgccaggatgccgagcgc
cacagtgacgttattgccgaattgacccgctatctgggtatgggggacttcgaccactgg
gatgaaaatgagaaacaagccttccttttaagagagctcaccagtaaacgtccgttaatc
cccacgaattggcaaccgagtgccaatgtcgccgaagtcataagcacttgtcgattgata
gcaactcaacctgcaaaagctctcggttcctatgtaatatctatggccagcaagccatcg
gatgtacttaccgtcttgctactactcaaagaaactggttgccctcatccaatgcgagtg
gtgccactgtttgagactctggacgatctcaataatgcagcaacttgtatgtcagcactc
ttcgccatcgattggtaccgtggatataccaaaggccatcaagagataatgatcggctat
tcagattcagccaaagacgccggcgtgatggctgcggcatgggctcaataccatgctcag
gagcaactggttgaaataagccggcaagccgatgttaagctcaccctgtttcatggacga
ggcggcacaattggacgtggtggcgggccggcacatgaagcgattctgtcacaacctccc
ggatctgtagatggccgcatccgcgtcaccgagcaaggtgaaatgatccgcttcaagttt
ggcctacctaaattggctgttcagagtctagccttatacacctcagcagtgatggaagcg
accttacttccaccacctgagcctaaacctgaatggcgcgcctgcatacaaaggctagcc
gaggagtcggtaaaagcctatcgttcaatagtcagagaagaaccagattttgtagcatac
tttcgagccgcaactcccgaagtagagctaggaaaattacctctaggaagtcgccctgca
aaacgtaaggttgatggaggtatcgaaagcctacgagcgattccctggatctttgcctgg
tcgcagaaccgcttgatgcttcccgcttggctaggcgcaggcgaggcacttcaggcttca
atcgataggggagatatgtccttattacaggagatggagcaagagtggcccttctttaag
actcgcatatcaatgctagagatggtttacgctaaggccgagccaaacttagctaagtat
tacgaaacctgtctggtaccggagaatcttcatcatcttggcgaagcattacgtgaaaga
ctggcgactggggttaaagccgtattagagctgactcaatccgataccttgatgtcccac
accccatggaacaaagaatcgattactttacgtaatccctatatcgatccactgaacttt
atgcaggcggagctgttagcgaggacacgtaaagaagatgcctctgctaatgttgaactg
gccttaatgttaaccatcgctggtgttgctgctggcatgagaaacaccggctga

DBGET integrated database retrieval system