KEGG   Sporosarcina psychrophila: AZE41_13125Help
Entry
AZE41_13125       CDS       T04327                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
spsy  Sporosarcina psychrophila
Brite
Enzymes [BR:spsy01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     AZE41_13125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AMQ06803
UniProt: A0A127VZJ0
LinkDB All DBs
Position
complement(2721964..2722566)
Genome map
AA seq 200 aa AA seqDB search
MTYKLPELPYAYDALEPHFDKETMNIHHTKHHNAYVTNLNNALEGNEELLNKSIEELIAN
LDAVPESKRTAVRNNGGGHANHSLFWELLSAEGGGNPSGALAEAIDNKFGSFDAFKEEFA
KAGATRFGSGWAWLVLNGGELEIMSTPNQDSPIMEGKTPLLGLDVWEHAYYLNYQNRRPD
YISAFWNVVNWDEVAKRFGK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgacttacaaattaccagaactaccttacgcttatgatgcacttgaaccacacttcgac
aaagaaacgatgaacattcatcacactaaacaccataatgcatatgtaacgaacttgaat
aacgctcttgaaggaaatgaagaacttctaaacaaatctatcgaagaacttattgcgaac
cttgatgcagtacctgaaagcaaacgtacggctgtccgtaacaacggtggcggtcacgca
aaccattcacttttctgggaacttttatcagcagaaggtggcggcaatccatcaggcgca
cttgctgaagcaatcgacaacaagtttggtagctttgatgcatttaaagaagaattcgca
aaagcgggtgcaactcgttttggatcaggatgggcttggctcgtactgaatggcggagag
cttgaaattatgtcaactccaaaccaagattcaccaatcatggaaggcaaaacgcctctt
ctaggactagacgtttgggagcatgcttactatctaaactatcaaaaccgtcgccctgac
tatatttcagcattttggaatgttgttaattgggacgaagttgcaaaacgtttcggtaaa
taa

DBGET integrated database retrieval system