KEGG   Sporosarcina psychrophila: AZE41_20085Help
Entry
AZE41_20085       CDS       T04327                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
spsy  Sporosarcina psychrophila
Pathway
spsy00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:spsy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AZE41_20085
Enzymes [BR:spsy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     AZE41_20085
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AMQ08047
UniProt: A0A127W399
LinkDB All DBs
Position
complement(4298714..4300192)
Genome map
AA seq 492 aa AA seqDB search
MQLNNYIGGTWQEAGGADYTAVLNPANGKELAQVRLSTKEDVSLAVKSAKEAQKKWALVP
APKRADFLYEIGRLMKEKKEHLSQVLTKEMGKVIEEARGEVQEGIDMAFYMAGEGRRMFG
ETVPSELQDKFAMSVRAPIGVVGLITPWNFPVAIATWKSFPAIVAGNTFIWKPATETPMM
AYEMALIFEEAGLPAGVANIVFGSGAEVGTAMIEHPDVRVISFTGSTETGRHVAETGGRH
LKKVSLEMGGKNAVIVMDDADIELAVEGILWSAFGTAGQRCTACSRVIVHTDVKEELEQK
LVEAMKVLSIGDGMDESVKIGPVINQKALDKIHGYVGIGKDEGAKLLAGGHILTDGKLAD
GHYYEPTLFTDVKWDSRLAQEEIFGPVVSLIEVSSLDEAIEVNNSVKFGLSSSIFSRDVN
KVFRAQRDLDTGIVYVNAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVFTEWKSIYIDF
SGKLQRAQIDTD
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgcaactgaacaattatatcggaggtacatggcaggaggcagggggagcagattatact
gcagtcttgaatccagcaaatggtaaggagttggcacaagtaagattatcgactaaagaa
gatgtgagtcttgcagtaaagtcggcgaaagaggctcagaaaaaatgggcactcgttccc
gcaccgaaacgtgcagactttttatatgaaattggacgacttatgaaagaaaagaaagaa
cacttatcgcaagtgttgacgaaagaaatggggaaggtcatcgaagaggcgcgcggtgaa
gtgcaggaaggcattgatatggcgttctacatggctggtgagggacgccgcatgttcggg
gaaacagtaccttcagagcttcaagacaagttcgcaatgagtgtccgtgcaccaatcggt
gttgtcggacttattacaccttggaactttccggtggcaattgcgacatggaaatcgttc
ccagcaattgtcgcgggcaatactttcatttggaaaccggcgacggaaacacctatgatg
gcgtatgaaatggcgcttatatttgaagaagcaggactcccagcaggcgttgcgaatatc
gttttcgggtcgggagcagaagttgggacggcaatgattgaacatcccgatgttcgcgtt
atttcattcacagggtcgactgaaacaggtcgtcatgttgcggaaacaggtggacgtcat
ttgaaaaaagtatcacttgaaatgggtggtaaaaatgcggtcatcgttatggatgatgcg
gatatcgaactggcagtggaagggattctttggagtgcattcggaacagcgggtcagcgt
tgtacggcatgtagccgtgtcatcgtgcatacagatgtaaaggaagaactcgagcaaaaa
ctcgtggaagcgatgaaagtgttatcgattggcgatggaatggacgaatcagtaaaaatt
ggcccagtaatcaatcaaaaagcgcttgataaaattcatggctacgtcggaattggtaag
gatgaaggtgcgaaacttcttgcaggtggacatatattaacagatggaaagcttgcagat
ggtcattattacgaaccaactttattcacagatgtgaaatgggatagccgccttgcgcaa
gaagagattttcggacctgttgtttcgctgattgaagtttcaagtctagatgaagccatt
gaggttaataacagtgtgaaatttggactttcaagttcgattttctcacgcgatgtcaat
aaagtattccgagcacaacgtgatctagatacgggtattgtctacgtgaatgcgggaacg
acgggtgccgaaatccatctgccattcggcggaacaaagggtacgggcaacggacaccgc
gattctggcgttgctgcactggatgtcttcactgaatggaagagtatttatatagacttc
agcgggaaattgcaacgggcgcagattgacacggattaa

DBGET integrated database retrieval system