KEGG   Sporosarcina psychrophila: AZE41_21905Help
Entry
AZE41_21905       CDS       T04327                                 

Definition
(GenBank) homoserine kinase
  KO
K00872  homoserine kinase [EC:2.7.1.39]
Organism
spsy  Sporosarcina psychrophila
Pathway
spsy00260  Glycine, serine and threonine metabolism
spsy01100  Metabolic pathways
spsy01110  Biosynthesis of secondary metabolites
spsy01120  Microbial metabolism in diverse environments
spsy01230  Biosynthesis of amino acids
Module
spsy_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:spsy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AZE41_21905
Enzymes [BR:spsy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.39  homoserine kinase
     AZE41_21905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AMQ08357
UniProt: A0A127W460
LinkDB All DBs
Position
complement(4657480..4658373)
Genome map
AA seq 297 aa AA seqDB search
MAESNFSVVVPASTANLGPGFDSIGLALNLYMTVNVSPSEDWEVTYKDDGFEDLPNGEDN
LIVKTVTNIAERKGRVAPASRLIIQSDIPLGKGLGSSATAIAAGIEIANQLLELNLSAKE
KVLLGSGYEGHADNISAALLGGVTISYFDGVEMDVVHIREPKMGAVILVPPEALLTEASR
GLLPDQLSHSEAIRSSAAGNVLSAAIARDDWETAGRMMEKDIFHEPYRKKLFPEFDRIRE
VCHEYGAYGMTISGAGPSLFVAVKQGNEGELAKRLAVAFPYYGCIAVKPSNAGAVVN
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atggcagaatccaatttttccgttgtcgtacctgcatcgacggcaaatcttgggccaggc
ttcgatagtatcggacttgcacttaatctttatatgacggtgaatgtatcgccgtcagag
gattgggaagttacgtataaagacgatggttttgaagatttaccgaacggtgaagataat
ttaattgtgaagacagttactaatatagctgagcgaaaagggcgtgttgcaccagcatca
cgacttatcattcagtcggatattccgcttggtaaaggacttggaagcagtgcaacggca
attgcagcaggaattgaaattgcaaaccaacttcttgaattgaatctttccgcgaaggaa
aaagtgcttctaggtagtggatatgaagggcacgcggataatatctcggctgcacttctt
gggggagtgacaatttcttattttgatggcgtggaaatggatgtcgttcatataagagaa
ccaaaaatgggagctgtgatacttgttccgcctgaggcattgctgacggaagcatctagg
gggcttctgccagaccaactctcacattcagaagcaatacgtagtagcgcagcggggaat
gtactttcagcagcgattgcccgggatgattgggaaacggcggggcgtatgatggaaaag
gatatctttcatgagccgtatcgtaagaagttatttcctgagttcgaccggatccgtgaa
gtttgccacgagtacggtgcgtatggcatgacaattagtggagcgggtccttctcttttc
gtggctgtgaaacaaggtaacgagggcgaattggcaaagcgattggcagttgcgttcccg
tactatggttgtattgctgtcaaaccgtctaatgcgggtgctgtggttaattga

DBGET integrated database retrieval system