KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1036Help
Entry
SPA1036           CDS       T00219                                 

Gene name
cspC
Definition
(GenBank) cold shock-like protein CspC
  KO
K03704  cold shock protein
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Brite
KEGG Orthology (KO) [BR:spt00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    SPA1036 (cspC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CSD OB_RNB
Motif
Other DBs
NCBI-ProteinID: AAV77007
UniProt: A0A0H2WN97
LinkDB All DBs
Position
1106376..1106585
Genome map
AA seq 69 aa AA seqDB search
MAKIKGQVKWFNESKGFGFITPADGSKDVFVHFSAIQGNGFKTLAEGQNVEFEIQDGQKG
PAAVNVTAI
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagattaaaggtcaagttaagtggttcaacgaatccaaaggttttggcttcatt
actccggctgacggcagcaaagatgtgttcgtacacttctccgctatccagggcaatggt
ttcaaaactctggctgaaggccagaacgttgagttcgaaattcaggacggccagaaaggt
ccggctgctgttaacgtaacagctatctga

DBGET integrated database retrieval system