KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1177Help
Entry
SPA1177           CDS       T00219                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00061  Fatty acid biosynthesis
spt00780  Biotin metabolism
spt01100  Metabolic pathways
spt01130  Biosynthesis of antibiotics
spt01212  Fatty acid metabolism
Module
spt_M00083  Fatty acid biosynthesis, elongation
spt_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:spt00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    SPA1177 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    SPA1177 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    SPA1177 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:spt01004]
    SPA1177 (fabI)
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     SPA1177 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     SPA1177 (fabI)
Lipid biosynthesis proteins [BR:spt01004]
 Fatty acid synthase
  Component type
   SPA1177 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AAV77138
UniProt: A0A0H2WPD8
LinkDB All DBs
Position
complement(1249417..1250205)
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSSIV
LPCDVAEDASIDAMFAELGNVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRTMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtcactggcgtggccagtaaactgtccatc
gcctacggtatcgcacaggcgatgcaccgcgaaggagctgaactggcgttcacctaccag
aacgacaaactgaaaggccgcgtagaagaatttgctgcccagctgggttccagcatcgtt
ttaccgtgtgatgtcgctgaagatgccagcattgacgctatgtttgcggagctgggtaac
gtttggccgaaatttgacggtttcgtacactcgatcggtttcgcgcctggcgatcagctg
gacggcgattatgttaatgcagttacccgcgaaggctttaaaatcgctcacgatattagc
tcttacagttttgttgccatggcgaaagcctgccgcaccatgctgaatccgggttctgcg
ctgttgaccttgtcttatctgggagcggagcgcgccatcccgaactacaatgtcatgggt
ctggcgaaagcctctctggaagctaacgtgcgttatatggcaaatgcaatggggccggaa
ggcgttcgcgtcaacgccatctctgcgggcccaatccgcacgctggcggcgtccggtatt
aaagacttccgtaaaatgctggcgcattgtgaagccgttacgccaattcgtcgcaccgtg
accattgaagatgtgggtaactcagcggcgtttctgtgttccgatctctcggcaggcatt
tctggcgaagtcgtccatgttgacggcgggttcagcattgcggcaatgaatgaactggaa
ctgaagtaa

DBGET integrated database retrieval system