KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA1253Help
Entry
SPA1253           CDS       T00219                                 

Gene name
sgcA
Definition
(GenBank) putative phosphotransferase enzyme
  KO
K02773  galactitol PTS system EIIA component [EC:2.7.1.200]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt00052  Galactose metabolism
spt01100  Metabolic pathways
spt02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:spt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPA1253 (sgcA)
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    SPA1253 (sgcA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:spt02000]
    SPA1253 (sgcA)
Enzymes [BR:spt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.200  protein-Npi-phosphohistidine---galactitol phosphotransferase
     SPA1253 (sgcA)
Transporters [BR:spt02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Galactitol-specific II component
    SPA1253 (sgcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTS_EIIA_2
Motif
Other DBs
NCBI-ProteinID: AAV77204
UniProt: A0A0H2WP06
LinkDB All DBs
Position
complement(1325058..1325495)
Genome map
AA seq 145 aa AA seqDB search
MINDVKWVQAQRHASDWRHALDIAVRPLITFGAAAPCYLDGIIENTLKWGPYYLIAPGIA
LPHARPEQGANHNQISVTTLSTPIAFGNADCDPIWLLLCASATDAEAHIRTIQRISQWLD
SPESVAMLQDAPNDAALFAQLAALR
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgattaatgatgttaagtgggttcaggcgcaacgccatgccagcgactggcgacacgcg
ctggatatcgccgtccgtccgctgattaccttcggcgcggcggccccctgctacctggac
ggtattattgagaacacccttaaatgggggccatattatcttatcgcgccggggattgcg
ctgccccatgccagaccggagcaaggcgccaaccataatcaaatcagcgtcactacgcta
tcaacgccgatcgctttcggcaatgcggattgcgatcccatctggctgttgctttgcgcc
agcgccacggatgccgaagcacatattcgcaccattcaacgcatcagccagtggctcgac
tcgccggaaagcgtcgcgatgttgcaagatgcgccaaatgatgccgcgcttttcgcgcaa
ttagccgcattacgctga

DBGET integrated database retrieval system