KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA2125Help
Entry
SPA2125           CDS       T00219                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase F52A protein (subunit F)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Brite
KEGG Orthology (KO) [BR:spt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPA2125 (ahpF)
Enzymes [BR:spt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPA2125 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored NAD_binding_8 FAD_binding_3 Thi4 Glutaredoxin K_oxygenase AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: AAV78017
UniProt: A0A0H2WQQ1
LinkDB All DBs
Structure
PDB: 

Position
complement(2209673..2211238)
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLRAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSDKVTFKEDNTLPV
RKPSFLITNPGSQQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQSLLKQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGTFQNEITERNVMGVPAVFVNGKE
FGQGRMTLTEIVAKVDTGAEKRAAEALNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVSDYDVDVIDSQSASKLVPAATEG
GLHQIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVVGLEYRDRVSGDIHSVALAGIFVQIGLLPNTHWLEGALERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTKIA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcagggcttaccttgagaaactgaccaaacct
gttgagctgattgccacgctggatgacagcgctaaatcggcggaaatcaaggaactgctg
gctgaaatcgccgagctgtccgacaaagtcacgtttaaagaagacaatactctgccggtg
cgcaagccgtctttcctgattacgaatccaggttctcagcaagggccgcgctttgccggt
tctccgctgggccacgaatttacctcgctggttttggcgctgctgtggaccggcggtcat
ccgtcaaaagaagcgcagtcgctgctgaagcagattcgcgatattgacggtgattttgaa
ttcgaaacttattattcactctcctgtcataactgcccggacgtagtgcaggcgctgaac
ctgatggcggtgctgaacccgcgtattaaacatacggcaattgatggcggcaccttccag
aacgaaatcaccgaacgtaacgtgatgggcgttccggcggtgtttgtcaacggtaaagag
ttcggccagggacgtatgactctgaccgagattgtcgctaaagtggatactggcgcagaa
aaacgcgcggcggaagcgctgaacaaacgcgatgcgtatgacgtgctgattgtcggctcc
ggcccggcgggcgcggcggcggcggtctactcggcgcgcaaaggcatccgtaccggtctg
atgggcgagcgcttcggcggtcaggtgctggataccgtggatatcgaaaactatatctcg
gtgccgaaaaccgaaggccagaaactggcgggcgcgctgaaagcgcatgtcagcgattac
gacgttgacgttatcgacagccagagcgcaagtaaactggttccggccgcgacagaaggt
ggcctgcatcagattgaaacggcgtccggcgcagtattgaaagcgcgcagtatcatcatc
gccaccggcgcgaaatggcgcaatatgaatgtgccgggcgaggatcagtatcgcaccaaa
ggcgtcacctattgcccgcactgcgacggtccgttatttaaagggaagcgtgtggcggtc
atcggcggcggcaactccggcgttgaagcggctatcgatctggcaggtattgtagaacat
gttacgttgctggagttcgcgccggagatgaaggcggatcaggtgctacaggacaaagtg
cgtagtctgaaaaatgtcgatatcattttgaatgcgcaaacgacagaagtgaagggcgac
ggttcgaaagtggtgggactggagtatcgtgaccgtgtcagcggcgatattcatagcgtc
gcgctggcagggatttttgtgcagattggtctgttgccgaatacccactggctggaaggc
gcgcttgagcgtaaccgcatgggcgagatcattattgacgccaaatgtgaaaccagcgtt
aagggcgtcttcgccgcaggcgattgtaccaccgttccttacaaacagattatcatcgcc
accggcgaaggggcgaaagcctcgttgagcgcctttgattatctgattcgcaccaaaatc
gcataa

DBGET integrated database retrieval system