KEGG   Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150: SPA2484
Entry
SPA2484           CDS       T00219                                 

Definition
(GenBank) probable lipoprotein
  KO
K11906  type VI secretion system protein VasD
Organism
spt  Salmonella enterica subsp. enterica serovar Paratyphi A ATCC9150
Pathway
spt03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:spt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SPA2484
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:spt02044]
    SPA2484
Secretion system [BR:spt02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPA2484
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AAV78360
UniProt: A0A0H2WRC4
LinkDB
Position
complement(2588642..2589178)
AA seq 178 aa
MNKWRNPTGWLCAVAMPFALLLLSGCGSSDALPDLESQRLDLSVKASDKVNPDNQKKAAP
IEIRVYELKNDAAFTTADYWSLHDNDKSVLTDDLVRRDSFILRPGEEKKLRRPLNAQTTA
IGVLAGYRNLAKSVWRVTYKIPEAPEKAWYSSFIPGKGKVQLEAELEQSAIVITERDK
NT seq 537 nt   +upstreamnt  +downstreamnt
gtgaataaatggcgtaaccccactgggtggttatgtgcggtagctatgccttttgcactg
ctcctgctttccggatgcggcagtagcgatgcgttacctgacctcgaatcacagcgcctc
gacctgagcgtgaaagcctccgataaggtgaatcctgacaatcagaagaaggccgcgccc
attgagatacgtgtttatgaactaaaaaatgacgccgctttcacgacagccgattactgg
tcgctccatgacaacgacaaatccgtccttaccgacgatttagtgcgtcgcgacagcttt
attttgcgtcccggcgaagagaaaaaactgcgtcgcccgctgaatgcgcagaccacggca
atcggcgtactggccggataccgtaacctggccaaatcggtctggcgggtaacctacaaa
atcccggaagccccggaaaaagcctggtacagcagcttcataccggggaaaggaaaagtg
cagttggaggcggaactggaacaaagcgccattgtaattacggaacgggataaatga

DBGET integrated database retrieval system