KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100888845
Entry
100888845         CDS       T01019                                 

Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2 Mst1_SARAH
Other DBs
NCBI-GeneID: 100888845
NCBI-ProteinID: XP_003726965
LinkDB
Position
Unknown
AA seq 523 aa
MSAKRQAAAVVTAAPVATSLPAEGPGTVTNESVNSQLPPSQRGPIGNIAASSSNFVVSSI
GGMFSKMTEYFEMQTISDSRGFGDRSTSTDDFDDDFYDSLDHLEGHPVSNNTNDNGQRRG
IFAGISSYFQPSKKYQAVPTHNNDNNNRRRDSSSVDGDLSNSSFSSFQDHMNTSFCEPYP
LIDESVNGEGVYVDDGREGEGGEGHKFVPTQLLNIITWCDKCGELIWGFYKQCLRCTYCK
YTCHYKCLNDVGLDCMESPELRKDTPDHSPQHTLVSVEDIENELESFVFLTREELEPKID
KFNTLRTQKSESLTLNEEGTLFSGRVTVNINLARPVSVRTGCPLPDICVSTLKQYEHSID
TNKRRTTFFMPKATSQELNITCYTTAQDVIRNVLAGLQLIDNPRKFALFERTEHNGEVFM
RKMVDEDRPLYMCLSWTSATGSKRFELRENETGVIEWEAFTVPELQNFLRILDKEEEEYI
QAVRRKYIKYQTLLQDTVDSTTSTTTTQQQKQSAPIHQKQISA
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgagtgccaagcggcaggcagccgcagttgtgacggcagctccagtcgcaacatcactg
ccagctgaaggaccaggaacggtcactaacgagtcggtcaacagccaactccccccaagt
caacggggccctatcggcaacatagccgcatcttcctccaactttgttgttagttctatc
gggggaatgttcagcaagatgacagagtattttgaaatgcaaacaatttctgattccagg
ggatttggggataggtctacctcaacggacgattttgatgatgatttttacgactcgttg
gaccatcttgagggccatcctgtgtccaacaacacaaacgataacggccagagaagagga
atttttgctggaataagcagttactttcaaccatcgaaaaaataccaagcagtgccaaca
cataacaatgataataacaacagaagaagagactcctccagtgtggatggagatctcagt
aattcatccttttcatcgtttcaggaccacatgaacacatcgttttgcgaaccatatcct
ctgattgacgaaagtgtgaatggggaaggggtatatgtagatgacggaagggaaggagaa
ggcggagaaggacacaaatttgtgccaacacaattgttgaatatcatcacgtggtgtgat
aaatgtggagaacttatctggggattctataaacagtgccttcgatgtacatattgtaaa
tacacatgtcactacaagtgcttgaatgatgtgggactggactgtatggagtcaccggag
ctgcggaaagacactccagaccactcgccgcagcacactctagtctcagtagaggacata
gagaatgagttagagagctttgtattcctgacgagggaggagttagaaccaaagattgac
aagttcaacacgctgaggactcagaagagtgaatcactcacactgaatgaggaagggact
ctgttcagtggccgagtgaccgttaacatcaacctggccagaccggttagtgtgaggaca
ggatgcccgctaccggacatctgtgtaagcacgctgaagcagtatgagcacagcattgat
accaacaagagacgaaccaccttcttcatgccaaaggctacctctcaggagctgaacatt
acctgctacaccacggcccaggatgtgatcaggaacgtcctagcgggacttcagctcata
gacaaccccaggaagtttgccctctttgagaggacagagcacaatggagaagtgttcatg
aggaagatggtggatgaagacagacctctctacatgtgcttgtcctggacttcagccacc
ggcagtaagaggtttgagctacgagagaacgagactggagttattgagtgggaggcgttc
acggtcccggagctccagaactttctgcggatcctagacaaggaggaggaggagtacatc
caggcggtccgacgcaaatacatcaagtaccagactctcctacaggacactgtagactcc
accacctccaccaccaccacccagcagcagaagcagagtgctcccatacaccagaagcag
atcagtgcttga

DBGET integrated database retrieval system