KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100889209Help
Entry
100889209         CDS       T01019                                 

Definition
(RefSeq) potassium voltage-gated channel subfamily KQT member 1 isoform X1
  KO
K04926  potassium voltage-gated channel KQT-like subfamily member 1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:spu04040]
    100889209
Ion channels [BR:spu04040]
 Voltage-gated cation channels
  Potassium channel, voltage-gated (Kv)
   100889209
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: KCNQ_channel Ion_trans Ion_trans_2 GCR1_C
Motif
Other DBs
NCBI-GeneID: 100889209
NCBI-ProteinID: XP_030845618
LinkDB All DBs
Position
Unknown
AA seq 599 aa AA seqDB search
MYPYFSTCSFHDPIPFTDRGRGFRDELNLDMYPYFSTCSFHDPIPFLFPAQLVQEIFLVV
FFSCEYVVRLWSAGCRQQYQGLRGRLRFARKPILIIDLIVVISSTAVMCFGSEGQVFAAS
AIRGVRFLQILRMLHIDRQGGTWRLLGSVVFIHRQELITTLYIGFLGLIFTSYFVYLAEK
DHIDAKGICQFETYADALWWGVVTVTTIGYGDKVPNTWLGKMIASCFSIFAISFFALPAG
ILGSGFALKVQHKQRQKHFSRQIPAAATLIQCAWRLYASNQEGFKSEATWKIHLAPSTPN
LQQSVPNQLSGVVNSVKPHLALKRRKSSKLSLKEALLPTTLLELCEQPAANQNAANSNTS
PPADKISPLMGGVACNLAGSVAVAAAGAGGDMVCYMEEPTAGNPNRKRAVELSVSDSSQR
TMRMGDIVCLDPHDESDTYSLPYVPETITTLTDAHKNAIRAIRKIRYYVARRKFQQARKP
YDVRDVIEQYSAGHLNMMVRIKELQRRIDTTLGKPASMHLGDRKRQTVVARVAVVEQNMQ
LMDRKLDKCMLLLNILVDRTTPQPVRRPKPSSKTTSSSSSSEDDEEEDSSRQAASGSTS
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgtatccttatttctctacctgttcttttcacgacccgatcccgtttactgatagggga
agggggtttagggacgagttaaaccttgacatgtatccttatttctctacctgttctttc
cacgacccgatcccgtttttgttccccgctcaactggtacaggaaatatttctggtggtt
ttcttcagttgtgagtacgtggttcggctctggtcagcaggctgcaggcagcaataccaa
ggactcagagggcgtctcaggttcgcaaggaaaccaattcttattatagatcttattgta
gtcatatcttctactgccgtaatgtgctttggatcagaaggtcaagtatttgctgcatca
gcaatcaggggtgtgcgttttcttcaaattcttcgtatgttgcacatagacagacaagga
ggaacatggagacttcttggttcagtagtatttattcatcggcaggagctgataaccaca
ttatacattggcttcctggggctcatatttacctcttattttgtatatcttgctgagaag
gatcatatagatgctaagggcatttgtcaatttgagacttatgctgatgctctatggtgg
ggtgtggtaactgtgacaaccattggctatggagacaaagtgcccaatacctggttgggc
aagatgatagcttcctgtttctcaatatttgcaatatctttcttcgctttaccggcgggt
attctaggttcagggtttgctttgaaggtacaacacaagcagaggcaaaaacatttcagt
cgtcaaattcctgcagctgctacccttattcagtgtgcctggagattatatgcctcaaat
caagagggtttcaaatcagaagcaacatggaaaatccacttagcgccctctacgcccaac
ctgcaacaatccgtgcctaaccaactatcaggggtggtgaactcagtcaaacctcacctc
gcattgaagcgacgtaagagctccaagctgagcctgaaggaggccctcctaccaacgacg
ctcctggagctgtgtgagcaaccagcagccaatcaaaatgcagctaattcaaatacctca
ccaccagcggataagatatctccgttgatgggcggggttgcttgtaacttggctgggtca
gtggcagtggccgcagcaggagccggtggtgatatggtgtgctatatggaagaacccaca
gcaggaaaccctaacagaaagagagcagtggagctatcggtatcagacagctcacagaga
acaatgagaatgggagatattgtttgccttgatcctcatgatgaaagtgatacttacagc
cttccctatgtgcctgaaacaataaccacactcacagatgcccataaaaatgcaattcgt
gcaataagaaaaattaggtattatgttgcaagaagaaaattccagcaagcaaggaaacca
tatgatgttcgtgatgtaatagagcagtactcagcgggccatttaaacatgatggtccgt
attaaagagcttcaaagaagaattgatactacgctaggaaaacctgcatctatgcattta
ggagacaggaagcggcaaacggttgttgctagagtcgcagtcgttgaacaaaatatgcaa
ttgatggaccgtaagctcgacaagtgcatgctacttctaaatattctggtggaccgaacc
acaccccaacccgtgaggagaccaaagccttccagcaaaaccacatcctcatcctcctca
tcggaagatgatgaagaggaagatagctctagacaggctgccagtggaagtactagctga

DBGET integrated database retrieval system