KEGG   Strongylocentrotus purpuratus (purple sea urchin): 100891935Help
Entry
100891935         CDS       T01019                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100891935
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100891935
Chromosome and associated proteins [BR:spu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100891935
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 100891935
NCBI-ProteinID: XP_011661900
LinkDB All DBs
Position
Un
AA seq 1664 aa AA seqDB search
MLAMENNVLNDYDTSSYESMLTLCDKYNRTIDAIRQLWKVSSCDSPISKRATPGLLKHIM
QQTYAHAIDDPDKLNCYEPFSPEVYGETSYDLVAQMLEHVKINEDDVFIDLGSGVGNVVL
QVAAATSCKLAYGIEKADVPAHYSEGMQKEYKRWMKWYGKEHSFFLLDHGDFLSDTMKEK
IASSNIIFVNNFAFGPRVDHQLKERFANMKEGAKIVSSKAFCPLNFRITDRNLSDIGSIM
DVVELSPLRGSVSWTGKPVSYFLHTIDRTLLEKYFQTLKDPKLREEYYKSCVRAKRPRRS
NIDYLASRSLDLGKTSSDSDSAVYGPTTRRQWSEWIANRDGMKENYDEMMEDSEKMDPDS
DVFSQASRRKRRRNKDSSETETPMPPPPKPAKQKTIKIPKKEEKKDSSLRGRGRPKKADN
VMSRRARDELKKSAALGMDLLHQHTVSLSQSPPDKSNGMLNNLGMSFNLASMVTPVKEKS
RPKSRERKPSHRQKKDLEASIQWLVDDYKMQLLQFLSYMKTPPYTDLVRKQLEEEKLYNE
QLNLKRGLLEDQISMLSKEGVRLLNQQLDKLGIQAKSPSELVAKSREIVGKHRELQERYQ
SLTTNMQLLEADNRKLVETRNQEVVTQLLGHSGKWDNSDSASNAKAASLITEQIIQEFSN
QQELKRQVQKLEFEVTTLEKIGETTKKPEKAAKKKRRNKGSEKSRKIKDIVGPPVSPPAI
KEDTLKHERLSGSYSSSPVHSKSWLGEGTPGTHKSPRAFQGGPGEGEHSYMSPGKVALQR
KLSNSMESSPMALRDDKGKEFASDVGQLMLNAHKQMQQTQKGYSGKVEPVHSSALHVVTS
SVAGGLQEGPMMHTSMASLGSRDGVPTATSSAGVHHLLQSCMISPLEMKHSGLYRFMPAA
QVSKVLNSSLDTSEPPLSPQNVTLYPPASGHPPDPRQDLTASSKVDTPTLSSLAMSHPTL
GRNVTDADSGRSSDASSSKEELTKISSASEAANTPTSTSSKKTESNKAKKSRKRPVPTSA
AEQNIPSKVAVTEKCNQPSQVGGAMTETQDIITMVTNVNQPLKISAIPSPEGAIAGQTGR
ESVPISQAENSGEKSNTNSDPETSNVRESPNTKKLQANISSKIDALAAFASSQLDRSKQI
RRQSAGNSPGDIHGSWDTHNPSQMPAGSRYMPTLHESQAGVRPAAAGPHDLLSAQLSNAG
LACATSIHGMTPAAPNPWQMAYMNKIQGSDEAGANSGKREQKEKKSEAKSANEPTMFVSG
HYTPKGKKPIPVKLSPKPLEQDPSGDELVPPKTPGKDFEEENIFSSSSLKQGSTVSNSSS
SSSTSTKTEVMTVVAKRNTVPPQEDTSYTDVQFHKKFSRKGNRWNCKPSSSLNVPGQEAQ
SKKHSAVGSSTQKKEGEGQKGKTQSPVPTVVLQRPPGHDPPKLAIKQQHSSHYHSKGSSS
TTSTSAVSSQQGTKYSSSSNHGKHDPNLGPFIELRSAGLKQVPNPPPGGAPITTQQTLLT
TSAGTQRFTGGTYYTSALASSGIHPQADLLDRSQNRGSGGSQSHSSLQSSTESYRSPFST
PPPPPSSRGTPSSSDSTHSDSHGSMRATPPSHGARSLPPTMSPLPSSVPLPGGYAMNGVM
PQYAVNQQTGDLGMPTYLPNTGNYMPVTHSGHGPSYLMQYGTPR
NT seq 4995 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctatggagaacaatgtcttgaatgactacgacacatccagctatgagagtatg
ttgacactgtgtgacaaatacaacaggactattgatgcaataagacaattgtggaaagta
tcatcatgcgactcgcccatttccaagagagcaacgcctggtctgttgaaacacatcatg
caacaaacctacgcccatgccatagatgaccctgacaagctcaactgctatgaaccattc
tcacctgaggtgtacggagagacttcatatgatctggtggctcaaatgttggaacatgtg
aagatcaatgaggatgatgtattcatagatcttggcagtggtgttgggaatgtggtgtta
caagtggctgctgcaacatcatgtaagctggcctatggaatcgagaaggcggacgtacca
gctcattattcagaggggatgcaaaaggaatacaagcgttggatgaagtggtatgggaag
gaacacagcttctttctactggaccatggtgatttcctctctgacaccatgaaggagaaa
atagcaagttccaacatcatcttcgttaacaactttgcatttggcccccgtgttgatcac
cagttgaaggagaggtttgccaacatgaaggaaggtgctaagatcgtgtcctccaaagct
ttctgccctctcaacttccgtataacagacagaaatctcagtgatataggcagcatcatg
gatgtggtggagctgtcccccctccgcggctctgtctcctggacaggcaagccagtgtct
tactttctacacacaatagatagaacgctgctggaaaaatactttcagacactcaaggat
ccaaaactcagggaagaatactacaaaagctgcgttcgagcaaagcgccccaggcgcagt
aacattgactacctcgcttcgagatcccttgatctcggcaagacttcgagcgacagcgac
tcggcagtctatggaccaaccacccgtcgccagtggtcggaatggattgctaatcgagat
ggaatgaaggagaactatgatgagatgatggaggatagtgagaagatggatccggattca
gatgtattctctcaagcttcaagaaggaaaaggcgcaggaataaagacagctcggaaacg
gaaactccaatgcccccaccgcctaaaccagctaaacaaaagacaatcaaaatccctaag
aaagaagaaaaaaaggactcctcattgagaggcagaggcagaccaaagaaggcggacaat
gtgatgagtcgtagggcccgggatgaactcaagaaatcagctgcattagggatggatctt
ctgcatcaacacacagtttcgctcagtcagtcacccccagataagagtaatggtatgttg
aataaccttgggatgtcctttaacctagcaagcatggtgaccccagtcaaagagaaatcc
aggcccaaatctagagagaggaaaccgagtcatcgtcagaagaaggacctagaggcgtcc
attcagtggcttgttgatgactataaaatgcaattgctgcaatttctatcctacatgaag
actcctccatacactgacctagtgaggaaacaattggaagaagaaaagttgtacaatgaa
cagctgaacctgaagcgtggtctcctagaggatcagatctccatgctgtccaaggagggt
gtacgactgctcaaccagcagctagacaagctaggcatccaggccaagtcaccgtcagag
ctggtggccaagtctagggagatcgtaggcaagcaccgggagctgcaggagaggtaccag
tctctcacgaccaacatgcagctccttgaagcagacaataggaaactagtggagactcgt
aatcaagaggttgtgacccagctgctggggcacagtgggaagtgggataacagtgacagt
gctagtaacgccaaggcagcttctctcattacagagcagatcatccaggagttcagtaac
caacaagaactcaagagacaggtccagaagttggagtttgaagtcactacactagaaaag
attggcgaaaccaccaagaaaccagaaaaggcagcaaagaaaaagcgtcgcaacaagggc
tctgagaagagtcgtaagatcaaagacattgtaggacctcctgtttcacctccagcaata
aaggaggatactcttaagcatgagagactatctgggagctactcaagcagtccagtacac
tccaagtcatggcttggcgagggtacaccagggacccataaatcacctagagctttccaa
ggtgggccaggggaaggggaacattcctacatgtcacctggcaaagtggcactgcagagg
aaactctccaattcaatggaaagcagtccaatggcgctgagagacgacaaagggaaggag
tttgcaagtgatgttggacaattgatgttgaatgcccacaagcagatgcagcagacgcag
aaaggatattctggcaaagttgaaccagtacattcctctgcgctgcatgttgtgacgagt
tcagtcgcaggaggtctccaagaaggtccgatgatgcacacctcaatggcatcccttgga
tccagggacggagtccccactgctacatcaagtgctggagtacaccatcttttgcagtcc
tgcatgattagtccgctagaaatgaagcactcgggtctctatcgcttcatgcctgcagcc
caggtcagtaaggtcctcaacagttctctagacacaagtgagcctccacttagtcctcag
aatgtgactctttaccctcctgcatctggacatccaccagaccccaggcaggatctgact
gcaagtagcaaggtggatactcctaccctatcatcccttgccatgagtcatcctacgctt
ggcaggaatgtcactgatgccgacagtggacgtagctctgatgcgtcctcgtccaaagaa
gaactcaccaagatatcctcagccagtgaggcagcaaacacccccacctcaacatcctcc
aagaaaacagaatcaaacaaagctaagaagagtcgcaagcgtcctgtcccaacatcagct
gctgagcagaacatcccttcaaaggtggctgtgacggagaaatgcaatcagccaagccaa
gtgggcggagctatgactgaaacacaggacattattaccatggtgaccaatgttaatcaa
cctttaaagattagtgcaatcccatcccctgagggagctatagctgggcagacgggtaga
gagagtgtaccgatatcacaggcagagaattcaggggaaaaatcaaatacaaattcagat
cctgaaacctccaatgtgagagagtcccccaacaccaaaaagctacaggcaaacatcagt
agcaagatagatgcccttgcagcattcgcttcatctcagttggatcgcagcaagcagatc
cgtcgtcagagtgccggcaacagcccaggagacattcatggttcctgggacacccacaat
cctagtcagatgcctgctggtagccgatacatgcctaccctgcatgagtcgcaggctggt
gtcagaccagcggcagcagggcctcacgatctactttctgcacagctgagcaacgctgga
ctggcgtgtgctacctcaatacacggcatgactcccgcagcacccaatccctggcagatg
gcctatatgaacaaaatccagggttctgatgaagcaggagctaatagtggaaaaagggaa
cagaaggagaagaaatcggaagccaaatcggccaatgagccaacaatgttcgtgagtgga
cactacacacccaaaggcaagaagcctatccctgtgaagctatctcccaaacctctagaa
caagacccctctggggatgagctagttcctccaaagacccctggaaaggattttgaagaa
gaaaacatttttagttcatcaagcttaaaacaaggcagcactgttagtaattctagtagt
agttcatcaacaagcactaagactgaggtaatgacggttgtagccaagcgtaatacagtt
ccaccacaggaggacactagttatacggatgttcagttccataagaaattctctcgtaaa
gggaacagatggaactgcaaaccctcctcctctctcaatgttcctggtcaggaagcacaa
agtaagaaacatagtgcagttggatcatcaacacagaagaaagagggcgaaggacagaaa
ggcaagacacaatccccagtgccgactgttgttctgcagagacctcctggtcatgatcca
cccaagctagccattaagcaacaacattccagtcattaccattctaaaggctcctcatct
acaacctccacctctgcagtgtccagtcagcagggaactaagtacagcagcagtagtaac
catggcaagcatgaccctaaccttgggccattcatagagcttaggtctgcaggcttaaag
caggttcctaacccaccaccaggtggtgcacccattactacgcaacagacccttctaaca
acgtctgccggcacccagcgcttcaccggtggcacctactacaccagtgccctggcatct
tctggcatccacccccaagcagacctactggaccgctcccagaatcgaggcagtggtggt
agccaatcccactccagcctgcagtcgtcgaccgagagctaccgatctcccttctccacc
cctcctccgccccccagctccagaggaacaccctcctccagcgactctacccactctgac
agccatggctcaatgcgagccacgcccccatcccatggggctcggtctcttccccctacc
atgtcgcccctacccagctcagtgccccttcctggagggtatgcaatgaacggtgtgatg
ccccagtatgcagtgaaccagcagacaggtgatctaggcatgcccacctatctcccaaac
actgggaattacatgccggtgacccattcaggccacggaccaagctacctcatgcagtat
ggaacaccaagataa

DBGET integrated database retrieval system