KEGG   Strongylocentrotus purpuratus (purple sea urchin): 105439311Help
Entry
105439311         CDS       T01019                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10-like
  KO
K04545  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
GTP-binding proteins [BR:spu04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    105439311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 105439311
NCBI-ProteinID: XP_011666456
UniProt: W4ZLB2
LinkDB All DBs
Position
Un
AA seq 65 aa AA seqDB search
MSQVTALKKTVEQLRSEAKIERITVSQACNQLQEYCLQHEADDCLLKGIAAHANPFKEKQ
KCTIL
NT seq 198 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaagtaacggcgctgaagaagaccgtagagcagctacgatcggaggcaaagatc
gaacggatcaccgtatctcaggcttgtaaccagctccaggaatactgcttacaacacgag
gcggatgactgtctactaaaaggaatcgctgcacatgccaacccgttcaaggaaaagcaa
aagtgcactattttgtag

DBGET integrated database retrieval system