KEGG   Strongylocentrotus purpuratus (purple sea urchin): 105444927Help
Entry
105444927         CDS       T01019                                 

Definition
(RefSeq) (R,R)-butanediol dehydrogenase-like
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N HTH_28 Glu_dehyd_C HTH_23 rve HTH_29 HTH_32 rve_3 UPF0175 Semialdhyde_dh ADH_zinc_N_2 HTH_8 HTH_31 HTH_DeoR FAD_binding_3 NAD_binding_2
Motif
Other DBs
NCBI-GeneID: 105444927
NCBI-ProteinID: XP_011678113
LinkDB All DBs
Position
Un
AA seq 624 aa AA seqDB search
MKAARFYDRGDIRIEDIPEPKVLPGTVGIQVAWCGICGTDLHEFMEGPIFIPPCGHPHPI
SGESAPVTMGHEFSGVVYAVGEGVDDIQIGQHVVVEPYIIADDVPTGPNDKYHLSKNMNF
IGLGGRGGGLSEKIAVQRRWVHPISNDIPLDQAALIEPLSVGHHAYVRSGAKAGDIALVG
GAGPIGLLLSAILKAKGLTVIITELSAKRKEKAIEAGVADYVLDPSKVDVVAEVMKITED
RGVDVAFECSSVNKVMDTLVAAMKPTGVVVIVSIWSHPATINVHSVVMKELDIRGTIAYV
NDHQETILLQEICDQRISQSQAAQLLHISERQIRRLLQKYKAQGPAALAHAARGQTSNSK
IPEELRLKCLNIVSDQFHGFGPTLAHEKLTSIHGFDISVETLRSWMIATNLWIPRSKRLK
RPYQPRYNRDCYGELIQIDGSHHDWFEGRAPKCCLLVFIDDATGSLQHLRFCESESTFDY
MLSTRAYIEQHGKPLAFYSDKHSVFRVNQSSKKDTKITQFGRVLNTLNIDIIFANSPQAK
GRVERANRTLQDRLIKEMRLEGISSIAEANIWLPRFIEQFNLKFAKIAFNPKDLHRSVTE
TPEELDDIFTWREPRRVTNSLTIT
NT seq 1871 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctcgtttttatgaccgaggggatattcgaattgaagatatccctgaaccg
aaagtacttccaggcacagttggaattcaagttgcgtggtgtggtatttgcggtacagat
ttacatgaattcatggaaggtcctatttttattccaccttgtggtcacccacacccaatt
tcgggagaatctgcacctgtaacaatgggacatgaattttcaggcgtggtttatgcagtt
ggagagggtgtagatgatatccaaattgggcaacatgtcgtagttgaaccctacatcatt
gctgacgatgtgccgactggccccaatgataagtatcatttatcaaaaaatatgaacttt
attggtttaggcggacgcggtggtggtctttctgaaaaaattgcagttcagcggcgttgg
gtacatcctatttcaaatgatattcctttagaccaagcagcattgatagaacctttatct
gtcggtcatcatgcctatgtcagaagtggcgcaaaagctggcgatatcgcactggttggt
ggagcaggcccaataggcttacttttatctgctattttaaaggctaaaggtctcacggtc
atcattactgaactgagtgcaaaacgtaaagaaaaagcgatagaagcgggtgttgccgat
tatgtactagacccatctaaggttgatgtagttgctgaggtaatgaaaattacagaagac
cgcggtgtagatgtcgcttttgaatgtagtagtgtcaataaagtcatggatacactcgtt
gcagcaatgaaaccaactggtgtagtcgttatcgtttctatttggagccatcctgccaca
attaatgtgcatagtgtggtgatgaaagagctagatattcgtggcacgattgcttatgta
aatgatcatcaggaaactatcctcttgcaagaaatctgtgatcaacgcattagccagtct
caggctgctcagctgcttcatatttcagagcgtcaaatcagacgcttattgcaaaaatac
aaagctcaaggtccagctgctttagcccatgcggcacgtggccaaaccagcaactctaag
attcctgaagaactcagattgaagtgcctcaatattgtctctgatcaatttcatggtttc
ggacccaccttagcccatgaaaagctgaccagcattcatggctttgatatttccgtggaa
acattgcgttcctggatgattgcaaccaatttgtggattcctcgctctaaacgcctgaaa
cgaccctatcagcctcgatataaccgggattgttatggtgaactgatccaaattgatggc
tcacaccatgactggttcgaaggacgtgctcctaaatgctgtctactggtgtttatcgat
gatgccacaggaagcttacagcacctacgtttctgtgaatcagaatcaacctttgactat
atgctttcaactagagcttatattgaacaacacggtaaaccattggcattttacagcgat
aaacattcagtctttagagtgaatcaaagcagtaagaaagacaccaagattacgcaattt
gggcgcgtactcaacacgctcaatatcgacatcatcttcgccaactcaccacaggccaaa
ggtcgtgtagaacgcgccaatagaacactacaggatcgcttgatcaaagagatgcgactg
gaaggcatctcctcaattgccgaagcaaatatttggttaccccgctttattgagcagttc
aatctaaaatttgcgaagatagcctttaatcccaaggatctacaccggagtgtcactgaa
acccctgaggaattagatgatatttttacttggcgtgagccacgtagagtcaccaacagc
ctgaccattac

DBGET integrated database retrieval system