KEGG   Strongylocentrotus purpuratus (purple sea urchin): 373245
Entry
373245            CDS       T01019                                 

Definition
(RefSeq) cyclin D
  KO
K04503  G1/S-specific cyclin-D1
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04068  FoxO signaling pathway
spu04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    373245
   04068 FoxO signaling pathway
    373245
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 373245
NCBI-ProteinID: NP_999664
UniProt: Q964G0
LinkDB
AA seq 302 aa
MDNLLCFEQEYFDHAKSPMSYVDQVLLRDKNLDNLLAVEEQYVLSADYFGNHFQRELRPS
MRKLVVDWMFEVCEEQQREEDVFPLSVNYLDRFLSIERISRDKFQLLGATCMFLASKLLE
TIPLTSEKLIIYTDNSITLEQLLKFEQLVLTKLKWDLMAITPNAFLEHIFHRLPVDKEQA
ALLRKHAQTFIVLCATDYNFAMQPPSLIAASGVAAAANGLRMHIPKVIDLLHRITKIETD
YLILVRDRMENLLSKNLVPGSPTKTAGHTTVQKTRSMDESDKPCTPTGVDEVEIITMPSG
LC
NT seq 909 nt   +upstreamnt  +downstreamnt
atggataatttgttgtgctttgagcaagagtatttcgaccatgccaaatcgccaatgtca
tacgtggaccaagttttattgcgagataaaaatctggacaatttactagcagtggaagag
caatatgtgttgtcggcggactattttggcaaccacttccagcgagaattgagaccttcg
atgagaaagctagtcgtggattggatgttcgaagtttgcgaggagcaacaacgagaagaa
gatgtgttcccactttcagtcaattacctggacagattcctatccatagagagaatatct
agagacaaattccagctcttgggcgccacttgtatgtttctggcctccaaacttctagaa
acgatccccctcacgtcggaaaaactaatcatctatacagacaatagtatcacattggag
caactactcaaatttgaacagctagtactaaccaagttaaaatgggaccttatggcaatc
acccccaacgcatttcttgagcacattttccaccggcttcccgtcgataaggagcaggca
gcgttgctaaggaaacatgcccaaaccttcatcgtgctgtgcgcgacagattataatttt
gcaatgcaacccccatcgttaattgccgccagcggtgtagctgcagcagcaaacggactt
agaatgcacatccctaaagtaatagatctactacataggataacaaaaatcgaaaccgac
tacctcattcttgttagagatcgaatggaaaacttgttgagcaagaaccttgtacctggc
tctccaaccaagaccgcaggacacaccacggtccagaagacacgatccatggacgagagt
gacaaaccatgcacaccaaccggcgtggacgaagtagaaattatcaccatgccaagcggt
ctctgctga

DBGET integrated database retrieval system