KEGG   Strongylocentrotus purpuratus (purple sea urchin): 578544Help
Entry
578544            CDS       T01019                                 

Definition
(RefSeq) polycomb complex protein BMI-1-A
  KO
K11459  polycomb group RING finger protein 4
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:spu03036]
    578544
Chromosome and associated proteins [BR:spu03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    PRC1 (polycomb repressive complex 1)
     578544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RAWUL zf-C3HC4_2 zf-C3HC4 zf-RING_2 zf-C3HC4_3 zf-rbx1 zf-RING_UBOX zf-RING_5 zf-RING_6 zf-Nse zf-C3HC4_4 Prok-RING_4 zf-C3HC4_5 zf-ANAPC11 zf-P11
Motif
Other DBs
NCBI-GeneID: 578544
NCBI-ProteinID: XP_783799
UniProt: W4Z5M0
LinkDB All DBs
Position
Un
AA seq 479 aa AA seqDB search
MHRKTRLKITDLNKHLTCSLCKGYIVDATSIIECLHSFCRSCIVRYLHTSKQCPVCDTQV
HKTRPLLNIRSDKTLQNLVYKLVPSMFKGEMKRRREFYKSHPQASTSLAQTVSREERGEM
DEQELIIYTDDEHLSLSLEYYQQSIHIPKPKPAAAAITRPVGNGDNASTSSSSGNSSCSD
TSSESGGSNVDVATGSAADGSTATGSAAGVSTAVGSAPGSSGGNTAAAPPIGDTRAVVSA
AVTAALKAAVSGAKQGGNAKVPEEKRGVQTDAAEMLAQERLKGKPNGATTLKSSCGPING
KTKANGDANGLSDEIVDKRYLRCPAAVSIGHIKKFIRHKFGLSLAYQIEVMYRGSEDELL
PDDYTLMDVAYIYTWGRVGPLPLVYRVYQPLSRPLKRTLTDKNTSVVPEKIPKKTDSSPH
QQKIPPAAGAKPKDASLNQGSQENTSPAMTPVVPPGAAKSNIALSIPTMPVSVVTLNRS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcaaaacgcggctgaagataacggatcttaataaacacctgacatgttcactg
tgcaaaggatatatcgtggatgctacaagcatcatcgaatgtttacattcattttgtcgg
agttgcatcgttcgatatctgcacaccagtaagcaatgcccggtatgcgacacacaggtt
cacaagactagacctctactaaatatcagatctgacaaaactttgcagaatctagtgtac
aaactggttccaagcatgtttaaaggagaaatgaaaaggagaagagagttttacaagtca
catccacaagccagtactagcctcgcacagaccgtatccagagaagaacgcggagagatg
gacgaacaagagctcattatttacaccgacgatgaacaccttagcctctcgctcgagtac
tatcagcagagcattcacatacccaaacctaaaccagccgccgccgccataacgcgtccc
gtcggtaacggggacaacgcgtcaaccagcagtagcagcggtaacagcagctgcagcgat
acgagcagtgagagcggcgggagtaatgtagacgtcgctactgggagcgccgctgatggg
agcaccgctactggcagcgccgctggtgtgagcaccgctgttgggagcgcacccggtagc
agtggaggaaataccgcagcggcaccgccgatcggagatacacgagccgtggtgagcgcg
gcggtcacggcggcactgaaggctgcggttagtggtgcgaagcaggggggcaacgctaag
gtaccggaagagaagcggggagttcaaacagatgcagctgaaatgttggcacaggagcga
ttaaaaggaaagccgaacggagcgacgacgttgaaaagtagctgcggtccgataaatggc
aagacgaaagcgaacggtgacgctaacggtctctctgatgagattgttgataaacggtat
ttgagatgtcctgcagctgtttccattggtcacatcaaaaagtttatccgacacaagttt
ggattatcactagcctaccagattgaagtgatgtacagaggtagtgaggatgaacttcta
ccagacgactacacattaatggatgtagcttacatttatacatggggtcgggtcggacct
ttgccacttgtttatcgagtctaccagccgctttccagaccactgaaaagaactctcacg
gacaaaaacacatcggttgtcccggagaaaataccaaagaaaacggactcttctccacac
cagcagaaaataccgccagcagctggagcgaaaccgaaagacgcttcgctgaaccaggga
tcgcaggagaacacatcacccgcaatgacgccggttgtgccgccgggtgcagcaaagtcg
aatattgcgttgagcatacctacaatgcccgtgtctgttgttacattgaacaggtcatag

DBGET integrated database retrieval system