KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580047Help
Entry
580047            CDS       T01019                                 

Definition
(RefSeq) histone-lysine N-methyltransferase NSD2
  KO
K11424  histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:spu00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    580047
Enzymes [BR:spu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     580047
Chromosome and associated proteins [BR:spu03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     580047
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PWWP SET HMG_box PHD HMG_box_2
Motif
Other DBs
NCBI-GeneID: 580047
NCBI-ProteinID: XP_011665023
LinkDB All DBs
Position
Un
AA seq 1736 aa AA seqDB search
MNSSDPPSQLPPPPHLYSDTPVRSSSLPTMQEVMGNSSPSKLLGLASSAQKPSPAAAASF
TSHSHIPVNPIPGPIHHKIAQPMRQAEPPQTLHHTFPSGPQEEPDSAPQPSSQQSFPHSA
AQPFMPQGQSTHPSNAYEEVVPTPDPSGSPVKMPITDASNSIGTDSDLDLQPVNVQPASE
SLGQVSPEPSGDIPVTGTPPDQMGTPIKQSSVIPTPPSDSGPFDTSEAMSPEIKIKIKKT
VNKGKSSLTATLLTNDGSPQKTSPSASDIESVAVTKRNLMSSIDGELPGDPTPTKPQTVA
QRRDTAKAVKGSSIPKGHFIKQPLPTNDEKPCEWLVGDLVWSKVSGHPWWPCMVAYDPNL
GIYTRMKGSIGKTYRMYHVQFFGEVPERGWVSGSSMKKFSGRDQYDSLVEEMVSKVRKAE
RSRMLSKLAVKPCRRNAWDAAISECEKALPMSRHERKLNFTFKYEMPKAGAGAAAEQIDI
VSLGDSPKMKAKRAYKKQKEEAPTPDASGDKQLQIDQTPEATKKESKKEKPESDTPKRKR
GRKTSQFLEFSKHFKKEIVKENPGIGQREIYEKLQEKWESLSEEDKEKYVTKPPTPPSTK
RERKRKGSPEQESETAAPVKRSKRESKPSKKLQEADLSSLGFSPKVVASIKKYSEASQSE
SQTSDGFLSPSREAVAPKKSRAKSLDAQPQPVPTAEASSTKRVRSRKSLQTPADATDKPG
KKKRSRKGESSVVEGGSGTTKPEAITSDMSQDFAEMQEDDDEGGLIIDTDLIADAIQSVG
EGHKGDPHSVASSETDVSSQHGGSTTGSSNGVANGSGKERPAGGGGAAKKENVCQVCERT
GQLLLCEGGCCGAFHLDCIGLQVAPSGSFRCDECISGVHSCFVCKLSDQEVRRCHVPVCG
KYYHEGCIRRFPLTRFDSRGFTCPLHACVACFADNPKSTKASRGRLMRCVRCPTAYHQGD
LCIAAGGIVLAANSLVCSRHFQPIKSHKHHTHVSVSWCFTCSLGGDLICCESCPAAYHAK
CLGFDSVPDGNWFCRDCVNGKKPRYGDIIWVKLGNYRWWPGRVCNPKDVPQNIQDKTHIV
GEFPVQFFGSNDYFWTHQGRVFEYQEGDKGSRETANSKRLAAVFSLALKEASQKYKLWRA
SKEQKLAKELEHSNKKPAPFKFIKTNRPVGNVVMPAFDITQCQACECRPDMENPCGPDSD
CLNRILLIECHPQICPAKEEKCQNQRFQKRAYPDSCQMKVSHRGWGLVAMVDIKKGDFVN
EYVGELVDEEECRRRIKQAHEENITDFYFLTLDKDRIIDAGPKGNLSRFMNHSCQPNCET
QKWTVNGDTRVGLFAIRNIAAGNEISFNYNLDCLGNEKKRCECGAPNCSGFIGVRPKTAA
AAAMEERSKQAKDKKKKRVRKRNKLQVVKVKHEDYCFRCAEGGELTMCDVKTCPKAYHLD
CLGLTKQPYGKWQCPWHHCDVCGKGSVKLCQECPNSYCKHHAGETTVIINDKVFCKEHDL
EDIERMEDEKARLALLKMEEDVAKMMQEVQAVKSEEEEEKAEKKKKRHRHRKVSGDESDK
KTKDKDEKKSRKGDRSTDGEEVVKKERKKHKKDKGDRGEKPKVNGIHGDEPEVKVEPLES
HAAELEASSDPVDEVALLEYDDDSEAELVIDETVVEKKKRDRKRQAEDSTEVSTDLQDSS
ISPKKKKKKEKKHKKDKENKRDKKDKERDKTSGKERKTDNVSNTTTKMVNGSLESD
NT seq 5211 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctctgatcctccgagtcaactccctcctccaccacatctctacagcgacacc
cctgtaagatcatccagccttcctaccatgcaggaggtgatgggaaactcctcaccatca
aagctccttggccttgcgtcgtctgcacagaagcctagtcctgcagcagctgcatccttt
actagtcacagtcacattccggtcaaccctatcccaggccctatccatcacaagatagca
cagccgatgcgccaggctgagccaccacagacgctccaccatacattccccagcggtcct
caggaagaaccggactctgcaccacagccttcttctcagcagtcctttcctcactcagct
gcacagcccttcatgccgcaaggacaatcgactcatcctagcaatgcatatgaagaagta
gtgccaactccagacccatctggctcccctgtcaaaatgccaatcacggatgcatcaaac
tctatcggaactgattctgatctcgatttgcagcctgtgaatgtacaacctgcttcagaa
tccctcggacaggtatccccagagccttctggtgatatcccagtgacaggcacacctcct
gatcagatgggcactcctataaaacagagttcagttattccaactccgccttctgattca
ggaccctttgacacttcagaagcgatgtcacccgagataaagattaaaataaaaaagact
gttaacaaagggaaatcgagccttactgcgacgttactcaccaatgacggatccccacag
aagacatcgcctagtgccagtgacatagaatctgttgctgttacaaagcgcaacctgatg
tccagtattgacggagaactgcccggtgacccgacgcccaccaaaccccagaccgtggct
cagaggagggatacagccaaggcggtcaaagggagtagcatcccaaaggggcattttatc
aagcagccactaccaaccaatgatgagaagccgtgcgagtggcttgttggagatcttgtc
tggtcaaaagtcagtggacatccatggtggccatgcatggtagcctatgaccccaacctg
ggaatctacaccagaatgaaaggttccattgggaaaacataccgaatgtaccatgtgcag
ttctttggagaggtcccggagagaggctgggtgagcggaagtagcatgaagaagttttca
ggacgtgaccagtatgattctctagttgaagagatggtcagcaaagtccgtaaggcagag
aggtcgcgcatgctgagcaagctagctgtgaaaccgtgcaggagaaatgcttgggatgcc
gccatttcagaatgtgagaaggcgctgcctatgagcagacacgaacgcaaactaaatttc
acattcaagtatgagatgcccaaggcaggtgctggtgctgcagctgaacaaatcgacata
gtgtcgcttggggattccccaaagatgaaagccaagagggcgtacaagaagcagaaagaa
gaagctccaactcctgatgccagtggtgataagcaactgcagatcgaccaaactccagaa
gcaaccaagaaagaaagcaagaaagaaaaacctgagtctgatacaccaaagagaaaacga
ggtcggaagacgagtcagttcttagagttctccaagcatttcaagaaggagattgtgaaa
gagaatcctggcatcggccagagggagatctatgagaaactgcaagagaagtgggagagt
ctgtctgaagaggataaggagaagtatgtgaccaagcctccaaccccaccctccactaag
agagagaggaagaggaagggttctccggagcaagagagcgagactgctgcacctgtgaag
agatccaagcgagaatctaaaccatccaagaaactccaagaagcagacctgtccagccta
gggttttcccccaaggttgtggcttccatcaagaaatatagcgaagcttctcaatcggaa
tcccaaacttctgacggctttctgtccccgtcaagagaagcagttgctcccaagaagagc
agggcaaaatcgttagatgcccaaccccaacctgttcccacggccgaggcttcaagcacc
aagagggtgaggtctaggaaaagcttgcaaactcctgctgacgccacggacaaacctggc
aagaagaagaggtcaagaaagggagagagttccgtcgtcgagggaggatcaggcaccacc
aaaccagaggctataacatcagatatgagtcaggactttgctgagatgcaggaggatgat
gacgagggcggtcttatcatcgatacagacctcattgctgatgccatccagtctgtcggt
gaagggcataaaggcgatcctcacagtgttgccagctccgagaccgatgtctcatcccag
catgggggtagtactactggaagctctaatggcgtagctaacggcagcggtaaggaacga
ccagccggagggggcggagctgccaagaaagagaatgtgtgccaggtctgtgagagaacc
ggtcagttgcttctctgtgaggggggctgctgcggagccttccaccttgactgtattgga
ctacaggtggcgccctctggctcattcagatgtgatgaatgtatatcaggcgtacattct
tgcttcgtgtgcaagctgtccgatcaggaagtgaggcgatgtcatgtcccagtctgtggg
aagtactaccacgagggatgtatccgacgcttcccgctgaccaggttcgatagtcgcgga
ttcacctgtccccttcatgcctgtgtagcgtgcttcgctgataaccccaagagcacaaaa
gcttcaagaggtcgtttgatgcgctgtgtgcgctgtcctacggcataccatcagggtgac
ctgtgcatagcagctgggggtatcgtcctagcggcaaactccctcgtctgtagccgtcac
tttcaaccaatcaaatcacacaagcatcatacacacgtcagcgtgagctggtgcttcact
tgttcattaggtggagatctgatatgttgtgagagctgtcctgcagcctaccatgccaag
tgtctaggctttgactcggtccctgatggaaactggttctgcagagactgcgtcaatggg
aagaagccacgctatggggatatcatctgggtcaaactcggcaattacaggtggtggcca
ggtcgtgtgtgtaaccccaaggatgtccctcagaacatccaggacaagactcatatagta
ggagagtttcctgtccagttctttggatccaatgactacttctggacccatcaaggaagg
gtctttgagtaccaggagggggacaagggaagcagggagacggccaactccaagaggctg
gccgctgtcttcagcttggctctgaaggaagcctcacagaagtacaaactctggagagca
tcgaaagaacagaagctcgctaaagaattagaacacagcaacaagaaacctgcaccattc
aagttcattaagacgaatcgtcctgttggtaatgtagtgatgccagcctttgacatcacc
cagtgccaagcatgtgagtgtcggccagacatggagaacccgtgtggaccagactcagac
tgtctcaacagaatactcctcatagaatgccacccacagatctgtcccgccaaagaggag
aagtgccagaatcagagatttcagaagagagcttacccagactcctgccagatgaaggtc
agccatagaggatggggtctggtggccatggtcgatatcaaaaagggtgacttcgtcaat
gagtacgtgggcgagttggtcgacgaggaagagtgtcgacgacggatcaagcaggcgcac
gaggagaacatcaccgacttctacttcttgaccctggataaagatcgcatcatcgacgcc
ggtcccaagggcaacctgtctcgtttcatgaaccattcgtgtcaacccaactgtgagacg
cagaagtggacagtcaacggagacaccagggtggggctcttcgctatcaggaacattgct
gcaggtaatgagataagcttcaactataatctggattgcctggggaatgagaagaagagg
tgtgaatgtggggctcctaactgcagtggattcatcggggtcagacctaagactgctgca
gcggctgctatggaggagcgatccaaacaagccaaagacaagaagaagaagcgggtccgc
aagaggaacaagctccaggttgtcaaggtcaaacatgaggactattgtttccgatgcgca
gagggcggagagctgaccatgtgcgatgtcaagacatgccccaaggcatatcatctcgac
tgcttaggtctaacgaaacagccctatggtaaatggcagtgtccctggcaccactgtgat
gtctgtggcaaggggtccgtcaagctctgtcaagaatgtccaaactcctactgcaagcac
catgcaggcgaaacgacagtcatcatcaacgacaaggtcttctgcaaagaacatgacctg
gaagatatcgagaggatggaagatgagaaagccaggctggccctcctcaagatggaagag
gatgttgctaagatgatgcaggaggtgcaggcggtgaaatcagaagaggaggaggagaag
gcagaaaagaagaagaagcgacacagacatagaaaggtgtctggagatgagagtgataaa
aagacaaaggataaagatgaaaagaagtccaggaaaggagacaggtcaacagatggagag
gaggtggttaaaaaagaaagaaaaaagcacaagaaagacaaaggggatagaggtgaaaag
ccgaaagttaatggtatccatggtgatgagccagaggtcaaagttgagcctttggaaagc
cacgctgccgagctggaagctagcagtgaccctgttgacgaggtagccctgcttgagtac
gacgatgacagcgaagcagaactggtgatcgatgaaactgtagttgagaagaagaaaaga
gataggaagcggcaagcagaggatagcacggaagtctcgactgacctacaggatagcagc
attagcccgaaaaagaagaaaaagaaagagaagaagcacaaaaaagacaaggaaaataaa
agagacaaaaaagacaaagagagagacaaaacatcaggaaaagagaggaagacggataat
gtatcaaacacaacaactaaaatggtcaatggttctctggaaagtgattga

DBGET integrated database retrieval system