KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580610Help
Entry
580610            CDS       T01019                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00020  Citrate cycle (TCA cycle)
spu00190  Oxidative phosphorylation
spu01100  Metabolic pathways
spu01200  Carbon metabolism
Module
spu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
spu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
spu_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    580610
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    580610
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     580610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 580610
NCBI-ProteinID: XP_011662952
LinkDB All DBs
Position
Un
AA seq 552 aa AA seqDB search
MEPDNWRWHMYDTVKGSDWLGDQDAIHYMTEEAPKAVIELENYGMPFSRTEEGKIYQRAF
GGQSYDYGKGGQAHRCCAVADRTGHSLLHTLYGQSLRYDTSYFIEYFALDLIMEDGECRG
VVALCMEDGSIHRIRAKNTVLATGGYGRAYFSCTSAHSCTGDGTAMLTRAGLANEDMEFV
QFHPTGIYGAGCLITEGCRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIRE
GRGCGPDKDHVYLQLSHLPPEQLAMRLPGISETAQIFAGVDVTRDPVPVLPTVHYNMGGV
PTNYKGQVIQYSDENGDTIVPGLYSCGEAACASVHGANRLGANSLLDLVVFGRACAHTIT
EENRPGEKIPDIKANAGEVSVANLDKLRYADGDIKAADLRLKMQRTMQNNAAVFRTGETL
SEGIDLIDDVYKNLDNIKLFDRGIVWNTDLVEALELQNLLLNSVQTMHSAEARKESRGAH
AREDFKDRIDEYDFKKPLEGQEKKPVEEHWRKHTMSHMDEHTGEVKLEYRPVIDETLDQQ
DCATVPPAVRSY
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggaaccagataactggagatggcacatgtatgacacagtgaaaggttcggattggctt
ggagatcaggatgccattcattacatgacagaggaggccccaaaggccgttatcgagctt
gagaactatggcatgcctttcagcagaacagaagagggcaaaatctaccagagagccttc
gggggtcagagctacgactacggcaagggaggtcaagcacataggtgctgcgctgtggca
gacaggactggtcattccctgctacatacgctctatggacagtctttgagatatgacaca
tcatacttcattgagtactttgctctggatctcattatggaggatggcgagtgtcgtggc
gtcgtggcgctgtgcatggaagacggctctatccataggatcagggccaagaacacagtc
ctcgctacaggtggctacggccgtgcatacttcagctgtacctctgcccattcatgcact
ggggatggtactgctatgctcaccagggctggtctggccaatgaagacatggagtttgtc
cagtttcaccccacaggtatctacggagcaggttgcctcatcacagaggggtgtcgtggg
gagggtggatacctcctcaacagcgagggtgagaggtttatggagaggtacgcccccacg
gccaaggacctcgcttccagggatgtcgtctcaaggtccatgaccattgagatcagggaa
ggaaggggctgtggtccagacaaggaccatgtatacctgcagctctcccatctcccacca
gagcagctggccatgagactgccaggcatctcagagacggcccagatcttcgccggtgta
gacgtgaccagggaccctgttccggtgcttcccacagtccactacaacatgggaggggta
cccaccaactacaagggacaggtgatacaatacagcgatgagaatggtgataccattgtg
cccggtttgtactcgtgcggagaggctgcctgcgcctctgtccatggggccaacagactg
ggtgccaactcactgcttgatctggtggtctttggacgcgcctgtgctcacaccatcacc
gaggagaacaggccgggagagaaaatcccagacatcaaagcgaatgccggtgaggtttca
gtggctaaccttgacaagctgaggtatgctgatggtgatatcaaggctgctgatctcagg
cttaagatgcagagaaccatgcagaacaatgccgcagtattcaggacaggagagacgttg
tcagagggtattgacttgatcgacgatgtctacaagaaccttgacaacatcaagctcttt
gatcgtggcatcgtgtggaacacagatctggtagaggcccttgagctacagaaccttctg
ttgaactcggtccagaccatgcacagcgctgaggcacgcaaggagagcaggggagcccat
gctagagaagatttcaaggatcgtattgatgagtacgacttcaagaaaccccttgaaggc
caggagaagaaacctgtcgaagaacactggagaaagcatactatgtcacacatggatgag
cacactggcgaggtcaagctagagtacagaccagtcattgacgagacccttgaccaacaa
gactgtgccactgtcccgccagcagtcagatcttactaa

DBGET integrated database retrieval system