KEGG   Strongylocentrotus purpuratus (purple sea urchin): 580712
Entry
580712            CDS       T01019                                 

Definition
(RefSeq) TGF-beta receptor type-2
  KO
K04388  TGF-beta receptor type-2 [EC:2.7.11.30]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu04068  FoxO signaling pathway
spu04144  Endocytosis
spu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:spu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    580712
   04068 FoxO signaling pathway
    580712
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    580712
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:spu01001]
    580712
Enzymes [BR:spu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     580712
Protein kinases [BR:spu01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   580712
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SpoIIIAH APH TMEM154
Other DBs
NCBI-GeneID: 580712
NCBI-ProteinID: XP_030828751
LinkDB
Position
Unknown
AA seq 591 aa
MFVSFLVTVPFVVTVSLGVASAFECLDCSEVPVECDAESCVPISCTTSVPCVGYCLIATF
PDMTSSSMTNGSDPSSQNINGMFACINETNPEIGGKKHCQAHPDDYSYAAEGSYSCSCAS
DGCNKVLYTAEATIPEEPTVPPSSEPDATPTKTKGPPIENTDPNKTEEGRKGQMLDREIL
VIVVCSVVPAVLLTIVIAVAGYIHFTRYRQPMNDELNTQTQTSNTESTSIDMTTDESETK
RLGEYSPPDSPLHLNGNYLPITLDELIGKGRFGAVWRAHWKINNGTKERTVAVKVFLEYD
SASWNVEKELFTDHSVMMRHEHIVQFISAEVRRVSVTSPTRQYWLITKYYKNGSLHDYLR
QRSVNWIDLCKLCGSAARGLAHLHAETYGSHGLHKVPVAHRDLKSTNILVKDDGSCAIAD
FGLAIRLDPQSSTDHLANSGQVGTPRYMSPEALECKVNLQDIESFKQMDTYALALILWEI
TSRCTLLKDINEYELPFSRSLGDRRASLEMMKTLVVLRRERPPITDEWLRNPGLTIIKNT
VVDCWDEDPEARLTASCVEARFQELILWHEGEPHAQSFYTSKGKRGRTTLV
NT seq 1776 nt   +upstreamnt  +downstreamnt
atgttcgtttcgtttcttgttacagttccgttcgtggttacggtatcccttggggttgct
tcggccttcgagtgtctcgactgcagcgaagtcccagtcgagtgcgacgccgaatcctgc
gttccgattagctgcacgacgtcggtgccgtgtgtcgggtattgtctgatcgctacattc
cctgatatgacgtcatcatctatgaccaatggctccgatccgtcgagccagaacatcaat
ggcatgttcgcctgcatcaacgaaacaaaccctgagataggcggaaagaaacattgtcag
gcgcatcctgatgactacagttacgctgcggagggatcctactcgtgctcttgcgccagt
gacggatgcaacaaggtactctacacggcagaggccactatacccgaagaacctacagtc
ccaccttcgagtgaacctgacgcaacccccaccaaaaccaaaggtccgccaattgaaaac
acagatccaaataaaacagaagaaggtaggaagggacagatgttggatcgggagattctg
gtcatcgtcgtctgttccgtagtgccggcagtcctcctcacgattgtgatcgccgtcgcc
gggtacatccacttcactcgataccgacaacccatgaatgacgaactaaacacccagaca
cagacgagcaacacggagagcacgagcattgacatgaccacggatgagagcgagacgaaa
cgactcggggagtacagtcctcctgacagcccgctccatctcaatggtaactaccttcct
attacactggacgagctcattggaaaaggacgcttcggcgccgtgtggcgggcacactgg
aagattaacaatggtaccaaagagcgtaccgtcgccgtcaaggtcttcttagaatacgac
tcagcatcgtggaacgtcgagaaagagctcttcacggatcactcagtcatgatgcgacac
gagcacattgtccagttcatctcggccgaagttcgtcgtgtcagcgtgacaagcccaact
cgtcaatactggcttatcaccaagtattacaagaatggttctctgcacgactatctgcgc
cagcgttctgtgaattggatcgacctctgtaagctttgtggttcggcggccagaggattg
gcacatcttcatgctgagacgtatggatcgcatgggttacacaaggtacctgttgcgcac
agagatctgaagagtaccaacatactggtgaaggacgatggctcatgcgccattgctgac
ttcggattggccatccgattagatcctcaatcttcaacggatcacctggcaaacagtggg
caggtgggtacccctcgctacatgtctcctgaagccttagaatgcaaggtcaatctgcag
gatattgaatctttcaagcagatggacacctatgccctggccctcatcctctgggagatc
acctcaaggtgtaccttactcaaagacataaacgaatacgagcttccattcagccgcagt
ctgggcgataggagggctagtctcgagatgatgaagacacttgtggtcctgaggagagaa
aggcctcccattacagacgagtggctcagaaatccaggtctcacgatcatcaagaacaca
gtggtggactgctgggacgaggacccagaggcgagactgacagcgtcctgcgttgaggca
cggttccaggaacttatcctgtggcacgagggtgagccacacgcacagtccttctacacc
agcaaggggaaaagaggcaggactactttggtctaa

DBGET integrated database retrieval system