KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581252Help
Entry
581252            CDS       T01019                                 

Gene name
LIG3
Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu03410  Base excision repair
Module
spu_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:spu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    581252 (LIG3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:spu03400]
    581252 (LIG3)
Enzymes [BR:spu01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     581252 (LIG3)
DNA repair and recombination proteins [BR:spu03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     581252 (LIG3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C zf-PARP zf-CCHH RNA_ligase mRNA_cap_enzyme Pex14_N DUF4482
Motif
Other DBs
NCBI-GeneID: 581252
NCBI-ProteinID: XP_011671479
LinkDB All DBs
Position
Un
AA seq 980 aa AA seqDB search
MRSKVYTAFNLGWSSLKRTFVRPEQQHLKHYTSAYRDAKCPCDSGLGRRGTASPKSFPGN
TLSSKFETERKGSIVFFQSFLSPTALSSSSTLVKTFSSVMDDEKSFMVDYARLGTSKCKK
CKQGIEKKSPRIAKLSTNPFSDDGSMMKNYFHINCVFETFVRARATTKKIEDPSDLDGFE
KMEEEEKKLIRKNIEELLSRVKTPKKTPAKKKATVQSVLSPGGQVVSSSKQPKPSTSQPS
SSHHTSAAASSSSSTPSPTPSKTSYQGDGSDPKHPDNSFREYRKLCARIADISGHHAKTK
VVAAYLKRGADGDTFSGDPYLVLKLLLPGVVKRVYNINSKQLVKLFSQIFGTDLDEMVTD
LEQGDVSETVRKFYEESKHTPPIKKSVLSIYDVDKFLDNMSMMTKELEQQRELAKITGKC
TANDLKMVVRLLKHDLRISSGAKHILDALDPNAYEAFQASRDLLDVVSRVLANQKASNGV
PGMTKKLSVRAALMTPVLPMLAEACKSVEMGMRKCPNGMYAEIKYDGERVQIHKQGDNFQ
YFSRSLKPVLPHKVTHIKDWIPKACPHGNSLILDSEILMVDKDGKILPFGTLGVHKKSAF
QDANVCLFVFDCLHFNGEDLMDKPLKTRRKILEENLDEIPNRIMLSESKFVTKTRQLSGL
IADVIREGLEGLVLKDVQSLYEPGKRHWLKVKKDYLKEGSMADSADLLVLGAFYGTGTKG
GMMSVFLMGVYDPNSDSFRTVTKCGNGLDDNTMDKVNRDLDMVKISKDSSKVPSWLRVNK
TLVPDFVIREPKKAPVWEIIGAEFTQSETHTAGGISIRFPRVTRIRDDKDFETATDLPRL
RTLFKKSKESTDVSAILGVQSSPSKVSAKRKKDDDDDDDDEEEITGFSFGKGGGTGASTS
AKGASPAKKAAESPAKKVKNERNGNNSNSPSPRKEKPTCKYGPDCYQKSKDHVEKFRHTG
SPSKQSPSKVCFNLDVLAEK
NT seq 2943 nt NT seq  +upstreamnt  +downstreamnt
atgagatctaaggtctacacagcatttaatcttggttggagcagcttgaaaagaacgttt
gtgaggcctgagcagcaacatcttaagcattacacttcggcctaccgggatgccaagtgt
ccttgtgatagtggcttaggtagacgcggtactgcatcaccaaagtcttttccaggaaat
acactctcatccaaatttgaaacagaacgtaaagggagtatagtcttttttcaatccttt
ttaagccctactgccctttcttctagttctactttggtaaagacattttcttcagtaatg
gatgacgagaaatccttcatggtagactatgcacggcttgggacgtcaaaatgcaagaaa
tgcaagcaggggatcgagaagaagtcgcctaggatcgccaagctctcaacgaatcctttc
agcgatgacggaagcatgatgaagaattatttccacatcaactgtgtgtttgagacgttc
gtccgggcgagagctacgacgaagaagatcgaggacccgagcgacttggatgggtttgag
aagatggaggaagaagaaaagaagttgatcaggaagaatattgaagagctgttatcaaga
gtcaagacacccaagaaaacaccagccaaaaagaaagccacagtacaaagcgtcctctca
ccgggcggacaagttgtatcctcgtctaaacaaccaaaacccagtacaagtcaaccctcc
tcctctcatcacacatcagcagcagcatcgtcctcatcatccaccccctcacccaccccc
tctaagacctcctaccagggggatggcagtgaccccaaacatccagacaattcattccga
gagtatcgcaagctctgtgcccgcatcgccgacatctccggccaccatgctaaaaccaaa
gtcgttgccgcgtaccttaagcgtggcgctgatggagatacattcagtggggatccctac
cttgttctcaagttgcttctacccggcgtagtgaagagagtctacaatatcaacagcaaa
caactggttaagcttttcagtcagatatttggaaccgacctggatgagatggtgactgac
ctagaacaaggagatgtatctgagacggtgaggaagttttacgaggagagcaaacacacg
cccccgatcaagaagagtgttctcagtatctacgatgtggacaagtttctagacaacatg
tctatgatgacaaaggaactcgaacagcagagggaacttgccaagatcaccggcaaatgt
acggccaatgacctcaagatggtggtccgtcttctgaaacacgaccttcgcatcagctct
ggagcaaagcacatacttgacgctctggaccccaacgcatatgaggccttccaagcctca
agggatctcctggatgtcgtcagtcgtgtcctcgccaaccagaaggccagcaacggagtg
ccgggcatgacaaagaagctgagtgtcagggccgctctcatgacaccagtcttacccatg
ctggctgaggcttgtaagtcagtcgagatgggcatgaggaagtgccccaacggcatgtac
gcggagatcaagtatgacggtgagagagtacagatccacaagcaaggggacaactttcag
tacttcagccggtccttgaaaccagtcctgcctcacaaggtgacccacatcaaggactgg
atcccaaaggcctgtccccatggcaacagtctcattctggacagtgagatcttgatggtt
gacaaagatggtaagatcctgccgtttggaacccttggtgtccacaagaaatcggccttc
caggatgccaacgtttgtctctttgtctttgattgtcttcacttcaacggagaagacctt
atggacaagcctctcaagacaaggagaaagatcctggaggagaacctagacgagatcccc
aaccgcatcatgctgtccgagtccaagtttgtcaccaagaccaggcagctctctggcctc
atcgcggacgtcatccgggaaggtcttgagggtcttgtcctcaaggatgtccagagcctg
tacgagccgggcaaacgccattggctcaaggtcaagaaggactacctcaaggaaggttcc
atggcggactctgccgatctcctggtgctgggagcgttctacggcactgggaccaaaggt
ggcatgatgtcagtcttcttgatgggtgtgtacgaccccaactctgactcgttccgcacc
gtcaccaagtgtggcaacggtctggatgataatacgatggataaggtcaaccgtgatctg
gacatggtcaagattagtaaggacagtagcaaggtgccgtcatggttacgagtcaataag
accctggtgccggactttgtcatcagagagcccaagaaagcgccagtgtgggagatcatt
ggagcagagttcactcaatcagaaactcacacagcaggaggcatctccatcaggtttcct
agagtgacacgtatccgtgacgataaagactttgagacggcaactgatctaccgagattg
aggacactattcaagaaatccaaggagagtactgatgtgagtgcaatactaggtgtccaa
tcctccccgtccaaggtgtctgcaaagaggaagaaggacgacgatgatgacgacgatgac
gaggaggagatcacaggattcagctttgggaagggtggaggaacaggagctagcacctca
gccaaaggggccagcccagccaagaaggcagcggagagtccggccaagaaagtgaagaat
gagaggaacggcaacaacagcaattcaccaagcccaagaaaggagaagccaacgtgcaag
tatggacctgattgctaccagaagagtaaagatcatgtggagaaattcagacacaccggc
tcaccatcaaaacaaagtccatctaaggtatgctttaatctagacgtcttggcggagaag
taa

DBGET integrated database retrieval system