KEGG   Strongylocentrotus purpuratus (purple sea urchin): 581706Help
Entry
581706            CDS       T01019                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
spu  Strongylocentrotus purpuratus (purple sea urchin)
Pathway
spu00010  Glycolysis / Gluconeogenesis
spu00053  Ascorbate and aldarate metabolism
spu00071  Fatty acid degradation
spu00280  Valine, leucine and isoleucine degradation
spu00310  Lysine degradation
spu00330  Arginine and proline metabolism
spu00340  Histidine metabolism
spu00380  Tryptophan metabolism
spu00410  beta-Alanine metabolism
spu00561  Glycerolipid metabolism
spu00620  Pyruvate metabolism
spu01100  Metabolic pathways
Module
spu_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:spu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    581706
   00053 Ascorbate and aldarate metabolism
    581706
   00620 Pyruvate metabolism
    581706
  09103 Lipid metabolism
   00071 Fatty acid degradation
    581706
   00561 Glycerolipid metabolism
    581706
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    581706
   00310 Lysine degradation
    581706
   00330 Arginine and proline metabolism
    581706
   00340 Histidine metabolism
    581706
   00380 Tryptophan metabolism
    581706
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    581706
Enzymes [BR:spu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     581706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 581706
NCBI-ProteinID: XP_786787
LinkDB All DBs
Position
Un
AA seq 525 aa AA seqDB search
MFSVGKLISATTSARQHAGRTLMRTSQYSVAAIPAPQKNPDIQHHKLFINNEWVNSVSGK
TFPTINPATEEVIAEVAEADKADVELAHAAASEAFRLGSPWRTTNASRRGALINKLADLV
ERDWAHLASLETLDNGKPYQDSYTIDVPGVLATLRYFAGWADKIEGKTIPVDGDFMTYTR
HEPVGVCGQIIPWNFPLLMLAWKWAPALACGNTIIMKTAEQTPLTALHMAELAKEAGFPP
GVINVLSGYGPTAGAAIASHPGIDKVAFTGSTEIGRIIAQSAGASNLKKVTLELGGKSPN
IILADADLDHAVEQSHSAIFWNMGQACCAGSRTFVEDKIYDEFVERSVERAKSKVVGDPF
DMSKDQGPQINDEQFKKILGLIESGKSDGAKLATGGGRHGDKGYYIQPTVFTDVKDDMKI
AREEIFGPVQSIFKFSEMNEVINRANNTEYGLAAAVFTKDIDKALYVSNSLRAGTVWINC
YNVVSPMAPFGGYKMSGTGRELGEYGLEAYTEVKTVTVKIPQKNS
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgttgggaaattgatctcggcgacgacatctgcccgtcagcatgcgggcagg
acgctgatgaggacgtcccagtattcggtggcggccattccagcaccacaaaagaatcca
gatatccagcatcataagctcttcatcaacaatgagtgggtgaactcggttagtggtaag
acgttccctaccatcaacccggcaacagaagaggtcatcgcagaggtcgcagaggctgat
aaggctgacgttgaacttgcacatgctgcggccagcgaagccttccgcctgggttcccct
tggcgtacaaccaacgcgtcccgaaggggtgcactgatcaacaaattggctgatttggtc
gaacgagactgggcacatcttgccagcctcgaaacgctggacaatggaaaaccataccaa
gattcttacaccattgatgtaccaggggtattagcaacactcagatactttgcaggatgg
gcggacaagatcgaaggcaaaacgatccccgtagacggagacttcatgacatatacgagg
cacgagccagtcggggtctgcggacaaatcatcccgtggaactttcctcttctgatgttg
gcatggaaatgggcccctgctctggcgtgtggaaataccatcataatgaagacggccgaa
cagactcccctcactgctctccatatggctgaactcgccaaagaggccggctttccacca
ggtgtgatcaacgtcttatcaggatatggacccacggcgggtgcagccatcgccagtcat
ccaggcattgacaaggtcgcgttcactggatctacagagatcggaagaattatcgcgcag
tcagcaggcgcttcaaacctcaagaaagtgacccttgaacttggcgggaaaagcccaaat
atcatcttggccgatgctgatcttgatcatgcggtggagcagagccattccgccattttc
tggaacatgggccaggcctgctgcgccggatccaggaccttcgttgaggacaagatctac
gatgagttcgtggaacgcagcgtagaacgtgccaagtccaaggtggtcggtgatccattc
gatatgtccaaggaccagggacctcagatcaacgacgagcaattcaagaagattttgggt
ttgatcgaaagcgggaagtcagatggagccaaattggcaacaggaggcggtcgtcatggt
gataagggatactacatccaaccaacggtgttcacagacgtcaaggatgacatgaagatc
gccagggaggagatctttggaccggtgcagagcatcttcaagttcagcgaaatgaacgag
gtgatcaaccgagcaaacaacacagagtacggtcttgcagctgcagttttcaccaaggac
atcgacaaggccctctacgtctcgaattcgctcagggcgggaaccgtctggatcaattgc
tacaacgtggttagccccatggctccattcggaggatacaagatgtcaggcacaggtcgt
gaacttggagagtacggtctggaggcatacactgaagtcaaaactgtgactgtgaagatc
cctcagaagaacagttaa

DBGET integrated database retrieval system